(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE27

ASHGO_7.PE27         Location/Qualifiers
FT   CDS             complement(70446..72884)
FT                   /codon_start=1
FT                   /gene_family="HOG000029414" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749028"
FT                   /gene_name="NIP1"
FT                   /locus_tag="AGL344C"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit C"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="eukaryotic translation initiation
FT                   factor 3 complex"
FT                   /protein_id="AAS54147.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005852"
FT                   /db_xref="HOGENOM:HBG354580"
FT                   /db_xref="HOGENOM:HBG608917"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR008905"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000025330C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751S5"
FT                   /transl_table=1
FT                   /translation="MSRFFSRGYHYDTASSSEDEELLTSSEEELMSSSEEEVVSDDSFF
FT                   NDSESESAESDDDSDGKPYGPDWFKKPQFRKGGAPGGSGASRFLKGNADSSDESDDEGK
FT                   KVVKSARDKLLDELNNTYNKIDAAEMTQDWTTILSEFESATKLLVKAQQQNMGTPNVFV
FT                   RVVAQVEDLVAETSQAEIKNKIVAKAYNTVKQRVRKIARENEELLAKFRQHPEAFEKDS
FT                   TVEFGQARDFDASDLTLMGRKVADRSAIVSSPSDFFSALRIVIDSRGKKGTDIQAQIKT
FT                   MEELVSISKSPYESIIAYLNLIPIRFDACANLAYQPLEQWKASHNNVTSLLELLEANIE
FT                   SYHVTELAPRNEFIEEEPQPNENGVRMILGSVFTFVERLDDEFNKSLLNTDPHSSDYLD
FT                   RLRDEQSVYNLILRSQLYLEKVLPEDTASKHLCRSFVRRLDHIYYKTSKLVDIVERAAW
FT                   ASVPANSSSKYITYSDDPDYNFKLVNTLCTVVSSEQEMLKRRATLYQIYYYALNNQFSK
FT                   AKEMLVQSNVRNSINSQDPTIQILFNRVVVQLGLAAFKLCLVEDCHQILNEVSTASHLR
FT                   DIMGQQSLQRVSNNISSNGTVTPTEMLCLPFHQHINLDLIDAVFMTCSLLIEIPHMAAF
FT                   YSGIKVKRIPYSQKSIRRALEHYEKSSFQGPPETLRDHVIHAAKAMQRGNWAQCINYLR
FT                   SISTWTLLGDKMEKVLEQLAERIQIESLKTYIFTYKRFYTKLSVQKLSELFSLPTEQVI
FT                   SVIQTLENTINIKGSLNEAKEMLIFDKGDEITKLEEVAIKLTKETKYQSERLNNVSQRQ
FT                   "
     MSRFFSRGYH YDTASSSEDE ELLTSSEEEL MSSSEEEVVS DDSFFNDSES ESAESDDDSD        60
     GKPYGPDWFK KPQFRKGGAP GGSGASRFLK GNADSSDESD DEGKKVVKSA RDKLLDELNN       120
     TYNKIDAAEM TQDWTTILSE FESATKLLVK AQQQNMGTPN VFVRVVAQVE DLVAETSQAE       180
     IKNKIVAKAY NTVKQRVRKI ARENEELLAK FRQHPEAFEK DSTVEFGQAR DFDASDLTLM       240
     GRKVADRSAI VSSPSDFFSA LRIVIDSRGK KGTDIQAQIK TMEELVSISK SPYESIIAYL       300
     NLIPIRFDAC ANLAYQPLEQ WKASHNNVTS LLELLEANIE SYHVTELAPR NEFIEEEPQP       360
     NENGVRMILG SVFTFVERLD DEFNKSLLNT DPHSSDYLDR LRDEQSVYNL ILRSQLYLEK       420
     VLPEDTASKH LCRSFVRRLD HIYYKTSKLV DIVERAAWAS VPANSSSKYI TYSDDPDYNF       480
     KLVNTLCTVV SSEQEMLKRR ATLYQIYYYA LNNQFSKAKE MLVQSNVRNS INSQDPTIQI       540
     LFNRVVVQLG LAAFKLCLVE DCHQILNEVS TASHLRDIMG QQSLQRVSNN ISSNGTVTPT       600
     EMLCLPFHQH INLDLIDAVF MTCSLLIEIP HMAAFYSGIK VKRIPYSQKS IRRALEHYEK       660
     SSFQGPPETL RDHVIHAAKA MQRGNWAQCI NYLRSISTWT LLGDKMEKVL EQLAERIQIE       720
     SLKTYIFTYK RFYTKLSVQK LSELFSLPTE QVISVIQTLE NTINIKGSLN EAKEMLIFDK       780
     GDEITKLEEV AIKLTKETKY QSERLNNVSQ RQ                                     812
//

If you have problems or comments...

PBIL Back to PBIL home page