(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE272

ASHGO_7.PE272        Location/Qualifiers
FT   CDS             827553..829880
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079297"
FT                   /gene_name="EBS1"
FT                   /locus_tag="AGL100W"
FT                   /product="Protein EBS1"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54391.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG059836"
FT                   /db_xref="InterPro:IPR018834"
FT                   /db_xref="InterPro:IPR019458"
FT                   /db_xref="UniParc:UPI00002533FE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751B2"
FT                   /transl_table=1
FT                   /translation="MTLTPMEDKGIIPNFNDFKRQLAELLQSRSTVEDITLLQGFLQLV
FT                   HSKTQQWRGAEGLPATPDLLDAVWKEIHYPIFKWFQQWRAHLLEAAEGGPQERTYISFR
FT                   RMNGKLNKIFKIIRQFYNGLVQQLFDRYDFGKLLPAGVIRELNVQSGGELQTLDDSSYF
FT                   TILCVMSLQRCLLYLGCCHRYKCCCSKLSKRFHISDFDDSMRYFMLAKQIVPSVGETYL
FT                   QEGLVYVQTGNYGHAAYAFMRGSLSRMPTDAGIPNLESIVADASSGLFAKHQGILKRLR
FT                   SKESDSNKLINREVLEFYFLALFSSVYAPESWSKQGSDIRHCTEILFEKVRSRYARNVR
FT                   LILQDVLLFIGGFDLVIKKAKAMGLNRSDTLPSNCTAFLETAFDFFSHVIDSVVLKEWQ
FT                   SFDTWEYLALVRVICVWIKSHSIVTQFAHRHTQFCQSVAHLLNNILAHTEYQQLMDVEH
FT                   RPKRDYFFQEDIMLKDFSAIGHTLSDFNDVDLFQMENLPDRLAGLVDDKLTAKEEGLLK
FT                   LHAIVFIGKKFLANNDVNIVWCDESKRFNSLKPDVPLRTCSPPKAKTPPPSTSDYTPAG
FT                   AKQTKKSKPKRNSRRVQSLSSLEAKLMERKGLRQSVAEGRVYSGCSVPAAPMSFDVAPS
FT                   AHLYQDRAAGTSATQEAATYYNQGYNGPMQLGSTEILNSRSPSGNNRIAFHPSHQAYMQ
FT                   MIQTPQPQAWPTAYGHNAYYSQPTQHPYPMSSQLAQFQNGPIPFVAGPYAMYMPPPGPG
FT                   MVVLNNGHPMIPNESPPQQHYP"
     MTLTPMEDKG IIPNFNDFKR QLAELLQSRS TVEDITLLQG FLQLVHSKTQ QWRGAEGLPA        60
     TPDLLDAVWK EIHYPIFKWF QQWRAHLLEA AEGGPQERTY ISFRRMNGKL NKIFKIIRQF       120
     YNGLVQQLFD RYDFGKLLPA GVIRELNVQS GGELQTLDDS SYFTILCVMS LQRCLLYLGC       180
     CHRYKCCCSK LSKRFHISDF DDSMRYFMLA KQIVPSVGET YLQEGLVYVQ TGNYGHAAYA       240
     FMRGSLSRMP TDAGIPNLES IVADASSGLF AKHQGILKRL RSKESDSNKL INREVLEFYF       300
     LALFSSVYAP ESWSKQGSDI RHCTEILFEK VRSRYARNVR LILQDVLLFI GGFDLVIKKA       360
     KAMGLNRSDT LPSNCTAFLE TAFDFFSHVI DSVVLKEWQS FDTWEYLALV RVICVWIKSH       420
     SIVTQFAHRH TQFCQSVAHL LNNILAHTEY QQLMDVEHRP KRDYFFQEDI MLKDFSAIGH       480
     TLSDFNDVDL FQMENLPDRL AGLVDDKLTA KEEGLLKLHA IVFIGKKFLA NNDVNIVWCD       540
     ESKRFNSLKP DVPLRTCSPP KAKTPPPSTS DYTPAGAKQT KKSKPKRNSR RVQSLSSLEA       600
     KLMERKGLRQ SVAEGRVYSG CSVPAAPMSF DVAPSAHLYQ DRAAGTSATQ EAATYYNQGY       660
     NGPMQLGSTE ILNSRSPSGN NRIAFHPSHQ AYMQMIQTPQ PQAWPTAYGH NAYYSQPTQH       720
     PYPMSSQLAQ FQNGPIPFVA GPYAMYMPPP GPGMVVLNNG HPMIPNESPP QQHYP            775
//

If you have problems or comments...

PBIL Back to PBIL home page