(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE273

ASHGO_7.PE273        Location/Qualifiers
FT   CDS             complement(830333..832576)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750182"
FT                   /locus_tag="AGL099C"
FT                   /orf_name="AGOS_AGL099C"
FT                   /product="AGL099Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54392.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059837"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00002533FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q750P6"
FT                   /transl_table=1
FT                   /translation="MDAQRTISKEVARGAESSGEKDAPERRRETVQRLQMPSSASGEPP
FT                   VSKPTTVPHNTPIISPSDSPRDGHSTGGSVGSSGSSPSPAAAAGALGHLPPQTAAARRI
FT                   SRSEKLSSAAVHVTPAASSGYNMGLGFTPNQRVQLPTIASLLAATGAGGMAAPPPVGCR
FT                   DGLRGEPLSIMDRGSMFMTSDSRGSARDAIRTPVERIPSSAPGHTSSAAAGGRLGRPHE
FT                   GELSARPETVSGSLCSSEASGALPRSTASTASNVSVGGSTGSAGSATSEAGDARRRSAV
FT                   DAGPVDGRTLSSIDANTALTPKRLHFNNSRDLIDPYTSEQHLSDVKINITSLLNSRGGT
FT                   GEDPYSLRAGGEFVLPVSANNNMMSIAPTSKSSATGGVTFQSQPPPSTGQLPPPSSASS
FT                   STHFLEPFSNGLMMDNDTQQQSTANGLNGSATMHTQRQTRFINSKFDEMRQRLLLTKPA
FT                   ARDDELGAAAIISQMRSSPYHTDFSSADANSRPVSSSINIQRNLKPVVQILQRENGTLV
FT                   KEEPNDQVLTDDELASSGEDDGLGDTITWNKGGKRQISRRKSALASSTAPSSASAAFKS
FT                   RSKRRRRSSGQSSMESLLSAAELLEMEANSKKNNRVFRTQPPHLTPTGKSPTSLSSSFA
FT                   VPDSSNKESPDKNLEEQFPNNISPKYDDAPNKKKAGAGTRSRTGCWICRLRKKKCSEER
FT                   PQCSNCLRLNLECVYDIIKPDFISDPDKKSEKLEEIKRRTKEAKRMAMKKKEW"
     MDAQRTISKE VARGAESSGE KDAPERRRET VQRLQMPSSA SGEPPVSKPT TVPHNTPIIS        60
     PSDSPRDGHS TGGSVGSSGS SPSPAAAAGA LGHLPPQTAA ARRISRSEKL SSAAVHVTPA       120
     ASSGYNMGLG FTPNQRVQLP TIASLLAATG AGGMAAPPPV GCRDGLRGEP LSIMDRGSMF       180
     MTSDSRGSAR DAIRTPVERI PSSAPGHTSS AAAGGRLGRP HEGELSARPE TVSGSLCSSE       240
     ASGALPRSTA STASNVSVGG STGSAGSATS EAGDARRRSA VDAGPVDGRT LSSIDANTAL       300
     TPKRLHFNNS RDLIDPYTSE QHLSDVKINI TSLLNSRGGT GEDPYSLRAG GEFVLPVSAN       360
     NNMMSIAPTS KSSATGGVTF QSQPPPSTGQ LPPPSSASSS THFLEPFSNG LMMDNDTQQQ       420
     STANGLNGSA TMHTQRQTRF INSKFDEMRQ RLLLTKPAAR DDELGAAAII SQMRSSPYHT       480
     DFSSADANSR PVSSSINIQR NLKPVVQILQ RENGTLVKEE PNDQVLTDDE LASSGEDDGL       540
     GDTITWNKGG KRQISRRKSA LASSTAPSSA SAAFKSRSKR RRRSSGQSSM ESLLSAAELL       600
     EMEANSKKNN RVFRTQPPHL TPTGKSPTSL SSSFAVPDSS NKESPDKNLE EQFPNNISPK       660
     YDDAPNKKKA GAGTRSRTGC WICRLRKKKC SEERPQCSNC LRLNLECVYD IIKPDFISDP       720
     DKKSEKLEEI KRRTKEAKRM AMKKKEW                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page