(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE280

ASHGO_7.PE280        Location/Qualifiers
FT   CDS             846798..848474
FT                   /codon_start=1
FT                   /gene_family="HOG000226729" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750184"
FT                   /locus_tag="AGOS_AGL092W"
FT                   /product="AGL092Wp"
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54398.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012715"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniParc:UPI0001DB2BEF"
FT                   /db_xref="UniProtKB/TrEMBL:Q751B1"
FT                   /transl_table=1
FT                   /translation="MAQVFNNQRSDTLFLGGEKVSGDDIRNQNVLAALAVANVVKSSLG
FT                   PVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVII
FT                   AAELLKRANELVKNKIHPTTIITGFRVALREALRYIEDVLSQPVDALARETMVNIAKTS
FT                   MSSKIIGSDSEFFSSMVVDALLAVKTQNGRGEVKYPVKAVNILKAHGKSACESVLVQGY
FT                   ALNCTVASQAMPRKLTGSVKIACLDINLQKARMAMGVQINVDDPDQLEEIRKREVGIVL
FT                   ERVKKIIDAGAQVVLTTKGIDDLCLKAFVEANVMAVRRCQKEDLRRIARATGAVLISSM
FT                   SNLEGDETFEPSYLGTCSEVVQAKFSDDECILIKGTAKHSSSSIILRGPNDYSLDEMER
FT                   SLHDSLCVVKRTLESGHVVAGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAAMLVIP
FT                   KTLAVNAAKDSSDLVAKLRSYHAASQQAKPDDLKKRKYRNYGLDLIRGKVVDEVGAGVL
FT                   EPTISKKKSLKSALEACIAILRIDTMITVDPEPPKEDPHAH"
     MAQVFNNQRS DTLFLGGEKV SGDDIRNQNV LAALAVANVV KSSLGPVGLD KMLVDDIGDF        60
     TVTNDGATIL SLLDVQHPAG KILVELAQQQ DREIGDGTTS VVIIAAELLK RANELVKNKI       120
     HPTTIITGFR VALREALRYI EDVLSQPVDA LARETMVNIA KTSMSSKIIG SDSEFFSSMV       180
     VDALLAVKTQ NGRGEVKYPV KAVNILKAHG KSACESVLVQ GYALNCTVAS QAMPRKLTGS       240
     VKIACLDINL QKARMAMGVQ INVDDPDQLE EIRKREVGIV LERVKKIIDA GAQVVLTTKG       300
     IDDLCLKAFV EANVMAVRRC QKEDLRRIAR ATGAVLISSM SNLEGDETFE PSYLGTCSEV       360
     VQAKFSDDEC ILIKGTAKHS SSSIILRGPN DYSLDEMERS LHDSLCVVKR TLESGHVVAG       420
     GGCVEAALNI YLDNFATTVG SREQLAIAEF AAAMLVIPKT LAVNAAKDSS DLVAKLRSYH       480
     AASQQAKPDD LKKRKYRNYG LDLIRGKVVD EVGAGVLEPT ISKKKSLKSA LEACIAILRI       540
     DTMITVDPEP PKEDPHAH                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page