(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE281

ASHGO_7.PE281        Location/Qualifiers
FT   CDS             849059..851659
FT                   /codon_start=1
FT                   /gene_family="HOG000001044" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622498"
FT                   /locus_tag="AGL091W"
FT                   /orf_name="AGOS_AGL091W"
FT                   /product="AGL091Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54399.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG192605"
FT                   /db_xref="HOGENOM:HBG203209"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000253405"
FT                   /db_xref="UniProtKB/TrEMBL:Q751B6"
FT                   /transl_table=1
FT                   /translation="MLSVREQVAEKLHLTSRKRNCILGKNSDMALEMQENAGRNMHSQY
FT                   SPRDSDRPRKRIEKVIELIEVDGKKVSKTATGKRKFHNKSKNGCDNCKRRRVKCDEGKP
FT                   GCQKCLKMRLSCVYTPAKPRKKKDRDVETVIKYVTRGNDEKDDGDVDTVIKYVTRGNDE
FT                   KDDSRDELGQQDNQNAPLAANLAVSGSQIEGAVPQTSPSVTPDASLLPPLFVGQNSQQL
FT                   QQQLMQQPHLLPQLMTLSNSERFATFELPNSPIPLQATAMNTTNSINSVFTNTRFASNL
FT                   LQQISQSPDQADLSSSVSKNGINLKQFGGPFPSAGIGGVTYDFQELIGIKAMTTKEPEV
FT                   TSQQQQISNVVTGNTSMLSKQPLVQCSSLEQQHSRASGRSTQHQPRQAQQRHSGSQPDH
FT                   QHRHQQLQQSHMPQLQDVQIQQTAAQQSPSIPVQDSLSQRGQSSATAVLSSLGSNGGSA
FT                   NMMDNPTISPIVLPMSPMSKASESVLVNNTSSTGVGDVSNSASRAAAGAKTQQNTSTRR
FT                   DSISASDNQLSEDTDGQMCTSDGCGILSFSKIIEFTQNSTLNLVDLRLFHHYCTKVWPT
FT                   IISAGISEQHIWSEHIPELAFRYPFLMHALLAFSATHLSRTEVGLEPFVACHRLESLKL
FT                   LREAVLQICEENTDALVASALILIMDSLANAASPNPAISSAAISPSAWIFHVKGAATIL
FT                   TAVWPLTPTSRFYNLINVDLSDLGDIINSDNGTVSELVCFDNSISDLYPVEIDSPYLIT
FT                   LAYLDKLHKEKDRSGFILRVFAFPALLDKTFLALLMTGDLGAMRIMRSYYKLLRGYATE
FT                   MKDRVWFLEGMTQVLPQDVDEYSGGGGMHMMLDFLGGGLPSMTTTNFTEFVYNE"
     MLSVREQVAE KLHLTSRKRN CILGKNSDMA LEMQENAGRN MHSQYSPRDS DRPRKRIEKV        60
     IELIEVDGKK VSKTATGKRK FHNKSKNGCD NCKRRRVKCD EGKPGCQKCL KMRLSCVYTP       120
     AKPRKKKDRD VETVIKYVTR GNDEKDDGDV DTVIKYVTRG NDEKDDSRDE LGQQDNQNAP       180
     LAANLAVSGS QIEGAVPQTS PSVTPDASLL PPLFVGQNSQ QLQQQLMQQP HLLPQLMTLS       240
     NSERFATFEL PNSPIPLQAT AMNTTNSINS VFTNTRFASN LLQQISQSPD QADLSSSVSK       300
     NGINLKQFGG PFPSAGIGGV TYDFQELIGI KAMTTKEPEV TSQQQQISNV VTGNTSMLSK       360
     QPLVQCSSLE QQHSRASGRS TQHQPRQAQQ RHSGSQPDHQ HRHQQLQQSH MPQLQDVQIQ       420
     QTAAQQSPSI PVQDSLSQRG QSSATAVLSS LGSNGGSANM MDNPTISPIV LPMSPMSKAS       480
     ESVLVNNTSS TGVGDVSNSA SRAAAGAKTQ QNTSTRRDSI SASDNQLSED TDGQMCTSDG       540
     CGILSFSKII EFTQNSTLNL VDLRLFHHYC TKVWPTIISA GISEQHIWSE HIPELAFRYP       600
     FLMHALLAFS ATHLSRTEVG LEPFVACHRL ESLKLLREAV LQICEENTDA LVASALILIM       660
     DSLANAASPN PAISSAAISP SAWIFHVKGA ATILTAVWPL TPTSRFYNLI NVDLSDLGDI       720
     INSDNGTVSE LVCFDNSISD LYPVEIDSPY LITLAYLDKL HKEKDRSGFI LRVFAFPALL       780
     DKTFLALLMT GDLGAMRIMR SYYKLLRGYA TEMKDRVWFL EGMTQVLPQD VDEYSGGGGM       840
     HMMLDFLGGG LPSMTTTNFT EFVYNE                                            866
//

If you have problems or comments...

PBIL Back to PBIL home page