(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE283

ASHGO_7.PE283        Location/Qualifiers
FT   CDS             853141..853881
FT                   /codon_start=1
FT                   /gene_family="HOG000091084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750185"
FT                   /locus_tag="AGL089W"
FT                   /orf_name="AGOS_AGL089W"
FT                   /product="AGL089Wp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="AAS54401.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="HSSP:1G65"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI0000253407"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N9"
FT                   /transl_table=1
FT                   /translation="MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCT
FT                   VLVNQKKVPDKLLEPSTVTYLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGY
FT                   DMPVHVLAKRFANLSQTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKAT
FT                   ATGPKQQELITALEKHFKKLQKDRLDEDSWEKVVEFAIGQMINSLGTDFSSKDLEIGVA
FT                   VAGKFFVLSQDQVEERLVAIAEQD"
     MSAAGYDRHI TIFSPEGRLY QVEYAFKATN QTNINSVAIR GKSCTVLVNQ KKVPDKLLEP        60
     STVTYLFPIA KHIGMCATGP IADARNVAVR CRAMAAEFRY EYGYDMPVHV LAKRFANLSQ       120
     TYTQRAYMRP LGVVLTFISV DEEEGPSIFK CDPAGYYTGY KATATGPKQQ ELITALEKHF       180
     KKLQKDRLDE DSWEKVVEFA IGQMINSLGT DFSSKDLEIG VAVAGKFFVL SQDQVEERLV       240
     AIAEQD                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page