(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE289

ASHGO_7.PE289        Location/Qualifiers
FT   CDS             864033..866603
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750188"
FT                   /locus_tag="AGL083W"
FT                   /orf_name="AGOS_AGL083W"
FT                   /product="AGL083Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54407.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059842"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000025340D"
FT                   /db_xref="UniProtKB/TrEMBL:Q750N3"
FT                   /transl_table=1
FT                   /translation="MNGATATATAAVGAEEEGGAREGSRRRDSVESAGDGRRRTKVSRA
FT                   CDQCRRKKIKCEYQEDAQSCSGCRKNSERCAFERVPLKRGPSKGYTRGEGAGDGARETE
FT                   GARGELDTSRADGKAAPVSLPPLHYYLPISNGQPGGAPAQAPAAPFPPMKQQFWKVPYY
FT                   ENQMQRRSSLESVNSDASGPQSQQETYAASSASTSSHQRTSRSYFPSSDGASALFQEPC
FT                   SSSYPPPLVRSSSTGGQLQQLPAPQYPYSQFAVALSGSTSASSQSVQLRTSATGSTSLP
FT                   EDSSPSSSNAYSPQLRAHCMSESLTTPTAGSKTGGSVKRRKRLSEPADPIVPLSAREPR
FT                   QAGHIGLPLQAQQATGKTGVICGKLSDAELIDAYYEYVHVNYPIIPINKETLTNEILLV
FT                   NTQPISEVHEMNNYILYWFRVALELLLHVASDKTNQDTASGMDSNAVHDGGLYAHRGDF
FT                   KQNEEHHVPHQSQLLAALNDCFRKLLDIHPKICAYQESTSPKVTTIYLSTYIIINYMLA
FT                   MLGEDNTFVLGTSVTVFNEFKIYRLLVLHEVADEPGDDSADVERHGFELLYKRLYYSLL
FT                   VFDALQSCCFGAPRLASLPISHLVEPLFAPPPPLDSAKWAVESDAARREPLLASIRLGA
FT                   LLTELCETRVLAGALPRAPTPALRAPRPFRVAPPADDSVPGAFFHALAAQRALLDRLLA
FT                   IPAHPAFAADAPPDATVDLCAQLGDAICRFTSCVLDTLVRAGPRPASPFAAALSRALHH
FT                   AINLSRNIPTSLIGCIIGTAVHHSRDRDLIVALSRCMSDMIQIQGLTHCLRPCAPPRPR
FT                   ARVSCDLRRLYGHDGPPASPHQVMLHQFIDIAWRLLRNDELGWF"
     MNGATATATA AVGAEEEGGA REGSRRRDSV ESAGDGRRRT KVSRACDQCR RKKIKCEYQE        60
     DAQSCSGCRK NSERCAFERV PLKRGPSKGY TRGEGAGDGA RETEGARGEL DTSRADGKAA       120
     PVSLPPLHYY LPISNGQPGG APAQAPAAPF PPMKQQFWKV PYYENQMQRR SSLESVNSDA       180
     SGPQSQQETY AASSASTSSH QRTSRSYFPS SDGASALFQE PCSSSYPPPL VRSSSTGGQL       240
     QQLPAPQYPY SQFAVALSGS TSASSQSVQL RTSATGSTSL PEDSSPSSSN AYSPQLRAHC       300
     MSESLTTPTA GSKTGGSVKR RKRLSEPADP IVPLSAREPR QAGHIGLPLQ AQQATGKTGV       360
     ICGKLSDAEL IDAYYEYVHV NYPIIPINKE TLTNEILLVN TQPISEVHEM NNYILYWFRV       420
     ALELLLHVAS DKTNQDTASG MDSNAVHDGG LYAHRGDFKQ NEEHHVPHQS QLLAALNDCF       480
     RKLLDIHPKI CAYQESTSPK VTTIYLSTYI IINYMLAMLG EDNTFVLGTS VTVFNEFKIY       540
     RLLVLHEVAD EPGDDSADVE RHGFELLYKR LYYSLLVFDA LQSCCFGAPR LASLPISHLV       600
     EPLFAPPPPL DSAKWAVESD AARREPLLAS IRLGALLTEL CETRVLAGAL PRAPTPALRA       660
     PRPFRVAPPA DDSVPGAFFH ALAAQRALLD RLLAIPAHPA FAADAPPDAT VDLCAQLGDA       720
     ICRFTSCVLD TLVRAGPRPA SPFAAALSRA LHHAINLSRN IPTSLIGCII GTAVHHSRDR       780
     DLIVALSRCM SDMIQIQGLT HCLRPCAPPR PRARVSCDLR RLYGHDGPPA SPHQVMLHQF       840
     IDIAWRLLRN DELGWF                                                       856
//

If you have problems or comments...

PBIL Back to PBIL home page