(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE30

ASHGO_7.PE30         Location/Qualifiers
FT   CDS             complement(77251..77820)
FT                   /codon_start=1
FT                   /gene_family="HOG000000770" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927761"
FT                   /locus_tag="AGL341C"
FT                   /orf_name="AGOS_AGL341C"
FT                   /product="AGL341Cp"
FT                   /function="protein phosphatase inhibitor activity "
FT                   /biological_process="regulation of phosphoprotein
FT                   phosphatase activity"
FT                   /biological_process="regulation of signal transduction "
FT                   /protein_id="AAS54150.1"
FT                   /db_xref="GO:0004864"
FT                   /db_xref="GO:0009966"
FT                   /db_xref="GO:0043666"
FT                   /db_xref="HOGENOM:HBG059850"
FT                   /db_xref="HOGENOM:HBG397087"
FT                   /db_xref="InterPro:IPR007062"
FT                   /db_xref="UniParc:UPI000025330F"
FT                   /db_xref="UniProtKB/TrEMBL:Q751R7"
FT                   /transl_table=1
FT                   /translation="MGGILKNPLSPHEQETHNAEPESVTEFRQQVLKNTRLNAQMTTRR
FT                   SSDLHNGAHGVPKDTLQLKRMHDEERLQWNQQNLDQNELTKQQFQDIHVDEPKTPYQGA
FT                   IDPEGEYYKHDDDDDDDGDLENFTLGDPEYSVPVPPVAQNGEPEGSQEADDDQAAQRRR
FT                   FEELRRKHYNVREAFSNRQLSEDEEE"
     MGGILKNPLS PHEQETHNAE PESVTEFRQQ VLKNTRLNAQ MTTRRSSDLH NGAHGVPKDT        60
     LQLKRMHDEE RLQWNQQNLD QNELTKQQFQ DIHVDEPKTP YQGAIDPEGE YYKHDDDDDD       120
     DGDLENFTLG DPEYSVPVPP VAQNGEPEGS QEADDDQAAQ RRRFEELRRK HYNVREAFSN       180
     RQLSEDEEE                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page