(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE308

ASHGO_7.PE308        Location/Qualifiers
FT   CDS             897851..899716
FT                   /codon_start=1
FT                   /gene_family="HOG000042487" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928057"
FT                   /locus_tag="AGOS_AGL068W"
FT                   /product="AGL068Wp"
FT                   /function="NAD+ or NADH binding"
FT                   /function="malic enzyme activity"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS54422.2"
FT                   /db_xref="GO:0004470"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG005452"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001DB2C14"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Z9"
FT                   /transl_table=1
FT                   /translation="MLRCIRRFSSRGAAASAVATGIPVGREAKRLMSKPLVTRLSVDGP
FT                   IECPLSGMQLLNSPLFNKGSAFTQEERAAFGLEGLLPPQVNTLDEQVERAYKQLCYLKT
FT                   PLAKNDFMTSMRMQNKVLFFELVRRHIRELVPIIYTPTEGDAIAAYSHRFRRPEGVFLD
FT                   ITEPDSIEERLASYGEDKDVDYVVVSDGEGILGIGDQGIGGIRIAISKLALMTLCGGIH
FT                   PGRVMAVTLDVGTNNKKLARDELYMGNRFARVRGKQYDEFLDKFIKALKKRFPSAVLHF
FT                   EDFGVENGRPLLDRYRNELPCFNDDIQGTGAVVMASFLAALKHTDRNLLDSKVLVYGAG
FT                   SAGIGIADQIVNHMVSYGASVDEARSKIFTMDRRGLIMDSMRAGSTRAQQAYAKPDDEW
FT                   EGVNTKSLVEVVSRIKPTCLIGCSTQAGAFNKAVVQEMHKHNERPIIFPLSNPTRLHEA
FT                   VPEDLLEWTNYQALVATGSPFHPVNGYRISENNNCFSFPGIGLGAVLARATIISDKMIS
FT                   AAVDQLASLSPLKPGDSRPGLLPPLEVINDTSAKVATAVILQALEEGLARVEHEAVPNS
FT                   TLGERVRVPRDFDKCLEWVKVQMWKPVYRPLLKVQHDPSVHTFQH"
     MLRCIRRFSS RGAAASAVAT GIPVGREAKR LMSKPLVTRL SVDGPIECPL SGMQLLNSPL        60
     FNKGSAFTQE ERAAFGLEGL LPPQVNTLDE QVERAYKQLC YLKTPLAKND FMTSMRMQNK       120
     VLFFELVRRH IRELVPIIYT PTEGDAIAAY SHRFRRPEGV FLDITEPDSI EERLASYGED       180
     KDVDYVVVSD GEGILGIGDQ GIGGIRIAIS KLALMTLCGG IHPGRVMAVT LDVGTNNKKL       240
     ARDELYMGNR FARVRGKQYD EFLDKFIKAL KKRFPSAVLH FEDFGVENGR PLLDRYRNEL       300
     PCFNDDIQGT GAVVMASFLA ALKHTDRNLL DSKVLVYGAG SAGIGIADQI VNHMVSYGAS       360
     VDEARSKIFT MDRRGLIMDS MRAGSTRAQQ AYAKPDDEWE GVNTKSLVEV VSRIKPTCLI       420
     GCSTQAGAFN KAVVQEMHKH NERPIIFPLS NPTRLHEAVP EDLLEWTNYQ ALVATGSPFH       480
     PVNGYRISEN NNCFSFPGIG LGAVLARATI ISDKMISAAV DQLASLSPLK PGDSRPGLLP       540
     PLEVINDTSA KVATAVILQA LEEGLARVEH EAVPNSTLGE RVRVPRDFDK CLEWVKVQMW       600
     KPVYRPLLKV QHDPSVHTFQ H                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page