(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE321

ASHGO_7.PE321        Location/Qualifiers
FT   CDS             complement(923783..924787)
FT                   /codon_start=1
FT                   /gene_family="HOG000141840" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622506"
FT                   /gene_name="YFH7"
FT                   /locus_tag="AGL055C"
FT                   /product="ATP-dependent kinase YFH7 "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /biological_process="cell killing"
FT                   /protein_id="AAS54435.1"
FT                   /db_xref="GO:0001906"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG059859"
FT                   /db_xref="HOGENOM:HBG203601"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="UniParc:UPI0000253428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750K6"
FT                   /transl_table=1
FT                   /translation="MDYEDLKKRVWDLLAQNIESNYRVAVVVVGHPGSGKSTMAQRLKR
FT                   DLNQEFQSHLKARRGGLRISAGIAAESLDETVPVASGALVEEARRGFFAHVEDPGFKPH
FT                   KFYDGDGTAVIFGRGGLPNSVRIASEALDPASSVNIAEVVPMDGFHLSRAHLDHFADAA
FT                   AAHKRRGAPWTFDSNNYLQLCKLLAATCKWKPAKRPKGETLMETICDTFAQCPVISYPG
FT                   FDHAAKDPVRDQHVLTGFTRVLIFDGLYLLYDQENWAHIYHSLASTGAVLVVNVTASEE
FT                   TRETRVATRHFAAGLVGSIEEGVRKFRENDLLNAKLIEEHTLGGVPTLILSND"
     MDYEDLKKRV WDLLAQNIES NYRVAVVVVG HPGSGKSTMA QRLKRDLNQE FQSHLKARRG        60
     GLRISAGIAA ESLDETVPVA SGALVEEARR GFFAHVEDPG FKPHKFYDGD GTAVIFGRGG       120
     LPNSVRIASE ALDPASSVNI AEVVPMDGFH LSRAHLDHFA DAAAAHKRRG APWTFDSNNY       180
     LQLCKLLAAT CKWKPAKRPK GETLMETICD TFAQCPVISY PGFDHAAKDP VRDQHVLTGF       240
     TRVLIFDGLY LLYDQENWAH IYHSLASTGA VLVVNVTASE ETRETRVATR HFAAGLVGSI       300
     EEGVRKFREN DLLNAKLIEE HTLGGVPTLI LSND                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page