(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE333

ASHGO_7.PE333        Location/Qualifiers
FT   CDS             complement(942596..943813)
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775049"
FT                   /locus_tag="AGL043C"
FT                   /orf_name="AGOS_AGL043C"
FT                   /product="AGL043Cp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54447.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI0000253434"
FT                   /db_xref="UniProtKB/TrEMBL:Q750J4"
FT                   /transl_table=1
FT                   /translation="MAAIQVSTVPVNTHDSGVKPYFEQKIQETELRIRTKTANLRRLEA
FT                   QRNALNDKVRFIKDELRLLQEPGSYVGEVVKVVSDKKVLVKIQPEGKYIVDIAKDINVK
FT                   DLKVSQRVCLKSDSYVLHKVLENKVDPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVI
FT                   ELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYI
FT                   GEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRTMLELLNQLDG
FT                   FETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRIHSRKMNLTRG
FT                   INLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMNKNDETAIS
FT                   VAKLFK"
     MAAIQVSTVP VNTHDSGVKP YFEQKIQETE LRIRTKTANL RRLEAQRNAL NDKVRFIKDE        60
     LRLLQEPGSY VGEVVKVVSD KKVLVKIQPE GKYIVDIAKD INVKDLKVSQ RVCLKSDSYV       120
     LHKVLENKVD PLVSLMMVEK VPDSTYDMVG GLTKQIKEIK EVIELPVKHP ELFESLGIAQ       180
     PKGVILYGPP GTGKTLLARA VAHHTDCKFI RVSGAELVQK YIGEGSRMVR ELFVMAREHA       240
     PSIIFMDEID SIGSSRVEGG SGGGDSEVQR TMLELLNQLD GFETSKNIKI IMATNRLDIL       300
     DPALLRPGRI DRKIEFPPPT VAARTEILRI HSRKMNLTRG INLRKIAEKM NGCSGADVKG       360
     VCTEAGMYAL RERRIHVTQE DFELAVAKVM NKNDETAISV AKLFK                       405
//

If you have problems or comments...

PBIL Back to PBIL home page