(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE334

ASHGO_7.PE334        Location/Qualifiers
FT   CDS             943947..944558
FT                   /codon_start=1
FT                   /gene_family="HOG000192807" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079308"
FT                   /gene_name="ALG13"
FT                   /locus_tag="AGL042W"
FT                   /product="UDP-N-acetylglucosamine transferase subunit ALG13"
FT                   /EC_number="2.4.1.141"
FT                   /function="N-acetylglucosaminyldiphosphodolichol N-
FT                   acetylglucosaminyltransferase activity"
FT                   /function="carbohydrate binding"
FT                   /biological_process="lipid glycosylation"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="AAS54448.1"
FT                   /db_xref="GO:0004577"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0030259"
FT                   /db_xref="HOGENOM:HBG298336"
FT                   /db_xref="HOGENOM:HBG629711"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniParc:UPI0000253435"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750J3"
FT                   /transl_table=1
FT                   /translation="MSTTTKSKMEGPKTVVVTCGATVPFPGLVNAVLDRRVLAELAQCG
FT                   FSRVMVQYGRGFAAEFERQVGAAGAVRAACDAEGLEGCDAHAWRWQGLEIIGFAFHAQM
FT                   ESLIGTSAALVVSHAGTGSILDALRQQKPLIVCVNEALLDNHQEQIARRFEALGHLWAI
FT                   RADVDELAGALARSTRETLAPLPPAYKQGFAELLQDVAHR"
     MSTTTKSKME GPKTVVVTCG ATVPFPGLVN AVLDRRVLAE LAQCGFSRVM VQYGRGFAAE        60
     FERQVGAAGA VRAACDAEGL EGCDAHAWRW QGLEIIGFAF HAQMESLIGT SAALVVSHAG       120
     TGSILDALRQ QKPLIVCVNE ALLDNHQEQI ARRFEALGHL WAIRADVDEL AGALARSTRE       180
     TLAPLPPAYK QGFAELLQDV AHR                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page