(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE340

ASHGO_7.PE340        Location/Qualifiers
FT   CDS             complement(960420..963134)
FT                   /codon_start=1
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751259"
FT                   /locus_tag="AGL036C"
FT                   /orf_name="AGOS_AGL036C"
FT                   /product="AGL036Cp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="transcription factor binding"
FT                   /biological_process="protein metabolic process "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54454.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008134"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="HOGENOM:HBG229122"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="HSSP:1KHY"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="UniParc:UPI000025343B"
FT                   /db_xref="UniProtKB/TrEMBL:Q750I7"
FT                   /transl_table=1
FT                   /translation="MNDETKFTNKALDIITIAQKLAQDHQHSTLVPLHVLAAFVETPAD
FT                   GSMGYLQNLIEKARYDYELFRRTINRQLVRLPSQTPAPSTIAPSQSFVQLLEKAAKLSE
FT                   QQKDSFIAQDHLLFALLEDATVAQIFKECSVEPEAVKQQALVLRGNQKIDSRGADTSTP
FT                   LEYLSKYAIDMTELAREGKLDPVIGREEEIRSTIRVLARRIKSNPCLIGEPGIGKTAII
FT                   EGVAQRIIDNDVPKILQGSKLFSLDLAALTAGAKYKGDFEERLKGVLKEIEESKTLIVL
FT                   FIDEIHMLMGNGKDDAANIMKPALSRGQLKVIGATTNNEYRAIVEKDGAFERRFQKIDV
FT                   AEPTVRQTIAILRGLQGKYEIHHGVRILDSALVSAAQLAKRYLPYRRLPDSAIDLVDIA
FT                   CAGVAVARDSKPEELDSKERELQLIQVEINALDRDKDSDPTTKERLMQAKQKEASLMEE
FT                   LEPLRQRYEEERRSHEELTKAKAKLEELENKALDAERRHDYGTAADIRYFAIPDLRKRI
FT                   GELEVEVAEEEQRLGQNTMIQNVVGSDAIAETAARLTGIPVNKLTESENEKLIKMERVL
FT                   AEQVVGQVEALKAVSRAVRLSRSGLSNPKQPASFLFLGLSGSGKTELAKKLAAFLFNDE
FT                   DAMIRIDCSELSERYSVSKLLGTTAGYVGYDEGGLLTNQLQRRPYSVLLFDEVEKAHPD
FT                   VLTILLQMLDDGRITSGQGKTIDCSNCLVIMTSNLGASYIASQPGARIEPATRDVVMAA
FT                   VRAHFRPEFLNRISSIVVFNKLSRKAIHKIVAIRLAEIEARFRDNDKHYKLDIAPDAVD
FT                   FLARHGYSEDMGARPLNRLIQTEILDKLALRILKGEIKDKETVKVTYAADRDALAVLAN
FT                   HPPSAGSHAEDMDIDDWDDLDNDDLVDGPAALD"
     MNDETKFTNK ALDIITIAQK LAQDHQHSTL VPLHVLAAFV ETPADGSMGY LQNLIEKARY        60
     DYELFRRTIN RQLVRLPSQT PAPSTIAPSQ SFVQLLEKAA KLSEQQKDSF IAQDHLLFAL       120
     LEDATVAQIF KECSVEPEAV KQQALVLRGN QKIDSRGADT STPLEYLSKY AIDMTELARE       180
     GKLDPVIGRE EEIRSTIRVL ARRIKSNPCL IGEPGIGKTA IIEGVAQRII DNDVPKILQG       240
     SKLFSLDLAA LTAGAKYKGD FEERLKGVLK EIEESKTLIV LFIDEIHMLM GNGKDDAANI       300
     MKPALSRGQL KVIGATTNNE YRAIVEKDGA FERRFQKIDV AEPTVRQTIA ILRGLQGKYE       360
     IHHGVRILDS ALVSAAQLAK RYLPYRRLPD SAIDLVDIAC AGVAVARDSK PEELDSKERE       420
     LQLIQVEINA LDRDKDSDPT TKERLMQAKQ KEASLMEELE PLRQRYEEER RSHEELTKAK       480
     AKLEELENKA LDAERRHDYG TAADIRYFAI PDLRKRIGEL EVEVAEEEQR LGQNTMIQNV       540
     VGSDAIAETA ARLTGIPVNK LTESENEKLI KMERVLAEQV VGQVEALKAV SRAVRLSRSG       600
     LSNPKQPASF LFLGLSGSGK TELAKKLAAF LFNDEDAMIR IDCSELSERY SVSKLLGTTA       660
     GYVGYDEGGL LTNQLQRRPY SVLLFDEVEK AHPDVLTILL QMLDDGRITS GQGKTIDCSN       720
     CLVIMTSNLG ASYIASQPGA RIEPATRDVV MAAVRAHFRP EFLNRISSIV VFNKLSRKAI       780
     HKIVAIRLAE IEARFRDNDK HYKLDIAPDA VDFLARHGYS EDMGARPLNR LIQTEILDKL       840
     ALRILKGEIK DKETVKVTYA ADRDALAVLA NHPPSAGSHA EDMDIDDWDD LDNDDLVDGP       900
     AALD                                                                    904
//

If you have problems or comments...

PBIL Back to PBIL home page