(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE35

ASHGO_7.PE35         Location/Qualifiers
FT   CDS             83770..84690
FT                   /codon_start=1
FT                   /gene_family="HOG000091080" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749032"
FT                   /locus_tag="AGL336W"
FT                   /orf_name="AGOS_AGL336W"
FT                   /product="AGL336Wp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="AAS54155.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="HSSP:1G65"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI0000253314"
FT                   /db_xref="UniProtKB/TrEMBL:Q751N3"
FT                   /transl_table=1
FT                   /translation="MRHLGRLQYATEPPINRGDGIIYIPFHEYQISVSNDNTRATSRGR
FT                   VANTAPVQLTSTSKEGGVHEQLGHCELVMFRNNYDGDTVTFSPTGRLFQVEYALEAIKQ
FT                   GSATVGLRSNKYVVLVALKRNADELSSYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQ
FT                   QCNYSQLVYARDLSVVKAGQLLSDKAQKNTQSYGGRPYGVGLLLAGYDNSGAHLLEFQP
FT                   SGNTLELYGAAIGARSQGAKTYLERVMEEYLEIEDADALIKHGVEALKHSLKDETLSTK
FT                   NLSIAIVGKDMPFTLYDGEAVAAYL"
     MRHLGRLQYA TEPPINRGDG IIYIPFHEYQ ISVSNDNTRA TSRGRVANTA PVQLTSTSKE        60
     GGVHEQLGHC ELVMFRNNYD GDTVTFSPTG RLFQVEYALE AIKQGSATVG LRSNKYVVLV       120
     ALKRNADELS SYQKKIIKCD DHMGLSLAGL APDARVLSNF LRQQCNYSQL VYARDLSVVK       180
     AGQLLSDKAQ KNTQSYGGRP YGVGLLLAGY DNSGAHLLEF QPSGNTLELY GAAIGARSQG       240
     AKTYLERVME EYLEIEDADA LIKHGVEALK HSLKDETLST KNLSIAIVGK DMPFTLYDGE       300
     AVAAYL                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page