(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE368

ASHGO_7.PE368        Location/Qualifiers
FT   CDS             1024201..1027737
FT                   /codon_start=1
FT                   /gene_family="HOG000036674" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622773"
FT                   /locus_tag="AGL008W"
FT                   /orf_name="AGOS_AGL008W"
FT                   /product="AGL008Wp"
FT                   /function="hedgehog receptor activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54482.1"
FT                   /db_xref="GO:0008158"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG196835"
FT                   /db_xref="HOGENOM:HBG326129"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="UniParc:UPI0000253457"
FT                   /db_xref="UniProtKB/TrEMBL:Q750G1"
FT                   /transl_table=1
FT                   /translation="MRTNEMLSVILVGVYLLVGLPCGRAAAQCAMYGNCGRQSAFGAEL
FT                   PCPVGADFTPEPLSADDSGFLASVCGPEWGSMDYVCCTRDQMVKLRANLKKAEAIIASC
FT                   PACAKNFAATFCHFTCSPAQRQFLDVKETELSTIGKRIVTEVDFYVESEYGESFYDSCK
FT                   NVKFSSTNGYAMDLIGGGAHNYKEFLNFLGDKKPSLGGSPFQINFKYSSETGQAPLNEK
FT                   TYACNDTEFRCACADCQESCPVLKPVKSGQCKVGKLPCLSFGALVAYGGAALALLLSYL
FT                   YVSRAKGDGVLLQDDAMGDDNEELNRQAEDELFHEYPTSRYRLNDVLADHLGSVAAYCI
FT                   KYPYHVLGATFAVVLILSSLIPFFGRLETDPVALWVSKRSPRFIEKQYFDENFGPFYRM
FT                   EQIFIANDNGPVLSYEHLDWWFTIEKEITSGLQSSDNTTFQDLCLRPTSDSTCVIQSVT
FT                   QYFDGILPPKSTWLEDLKTCAESPVSCLPSFQQPLNSKLLFSHENITESNALVISLPVD
FT                   NHTQSAELWEQTLEDYLSKLDVPKGLRLSFSTESSLSKELGKNNDVTIVLISYVIMFFY
FT                   ASWALKNKMGKQRFLLGGTGILIVFCSILSAVGMLSALGLSSTLIIAEVIPFLILAIGV
FT                   DNIFLLTGEYDRTTAGNTSLSIEDRILISVRKIAPSIVTSVVCQTVCFLLAAFVGMPAV
FT                   RNFALYSAAALFFNFLFQITAFVSILTLYENKYESYLSNTSLEQEPPFFLPKLRNVILK
FT                   KSTAIVFIVWSLASIVFLPYISIGLDQKMAVPQDSHLTTYFEDVSQYLNVGPPVYFVLR
FT                   NLDLTKRENQKKICGKFTTCNEFSLANVLEQERNRSTITEPLTNWYDDFMMFLNPALDE
FT                   CCRLKKGSQEVCPPRYPFRRCQTCYPPGTWDYDMTDFPEDGEFMRFFKIWIDAPSEPCP
FT                   LGGKAPYSSSIIYNDSVIEASMFRSYHSPLRTQKDYIAAYKDAERITGEFKDLDVFAYS
FT                   PVYIFFDQYRSLVSLTLKLLAVALITMFWISLVMLGSVSTALLLTGTVFMILVDIGASM
FT                   VLFNIPLNAVSLVNLVICVGLAVEFCIHIARAFTLVPVGIKNSRPSRSVYALASVGESV
FT                   FRGITMTKLIGVCILFFAQSKIFQVFYFRMWLSLILIASLHALIFLPTALAFLGGQSYV
FT                   EGNSEVRLVDAE"
     MRTNEMLSVI LVGVYLLVGL PCGRAAAQCA MYGNCGRQSA FGAELPCPVG ADFTPEPLSA        60
     DDSGFLASVC GPEWGSMDYV CCTRDQMVKL RANLKKAEAI IASCPACAKN FAATFCHFTC       120
     SPAQRQFLDV KETELSTIGK RIVTEVDFYV ESEYGESFYD SCKNVKFSST NGYAMDLIGG       180
     GAHNYKEFLN FLGDKKPSLG GSPFQINFKY SSETGQAPLN EKTYACNDTE FRCACADCQE       240
     SCPVLKPVKS GQCKVGKLPC LSFGALVAYG GAALALLLSY LYVSRAKGDG VLLQDDAMGD       300
     DNEELNRQAE DELFHEYPTS RYRLNDVLAD HLGSVAAYCI KYPYHVLGAT FAVVLILSSL       360
     IPFFGRLETD PVALWVSKRS PRFIEKQYFD ENFGPFYRME QIFIANDNGP VLSYEHLDWW       420
     FTIEKEITSG LQSSDNTTFQ DLCLRPTSDS TCVIQSVTQY FDGILPPKST WLEDLKTCAE       480
     SPVSCLPSFQ QPLNSKLLFS HENITESNAL VISLPVDNHT QSAELWEQTL EDYLSKLDVP       540
     KGLRLSFSTE SSLSKELGKN NDVTIVLISY VIMFFYASWA LKNKMGKQRF LLGGTGILIV       600
     FCSILSAVGM LSALGLSSTL IIAEVIPFLI LAIGVDNIFL LTGEYDRTTA GNTSLSIEDR       660
     ILISVRKIAP SIVTSVVCQT VCFLLAAFVG MPAVRNFALY SAAALFFNFL FQITAFVSIL       720
     TLYENKYESY LSNTSLEQEP PFFLPKLRNV ILKKSTAIVF IVWSLASIVF LPYISIGLDQ       780
     KMAVPQDSHL TTYFEDVSQY LNVGPPVYFV LRNLDLTKRE NQKKICGKFT TCNEFSLANV       840
     LEQERNRSTI TEPLTNWYDD FMMFLNPALD ECCRLKKGSQ EVCPPRYPFR RCQTCYPPGT       900
     WDYDMTDFPE DGEFMRFFKI WIDAPSEPCP LGGKAPYSSS IIYNDSVIEA SMFRSYHSPL       960
     RTQKDYIAAY KDAERITGEF KDLDVFAYSP VYIFFDQYRS LVSLTLKLLA VALITMFWIS      1020
     LVMLGSVSTA LLLTGTVFMI LVDIGASMVL FNIPLNAVSL VNLVICVGLA VEFCIHIARA      1080
     FTLVPVGIKN SRPSRSVYAL ASVGESVFRG ITMTKLIGVC ILFFAQSKIF QVFYFRMWLS      1140
     LILIASLHAL IFLPTALAFL GGQSYVEGNS EVRLVDAE                              1178
//

If you have problems or comments...

PBIL Back to PBIL home page