(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE369

ASHGO_7.PE369        Location/Qualifiers
FT   CDS             1027911..1029521
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751272"
FT                   /gene_name="AEP3"
FT                   /locus_tag="AGL007W"
FT                   /product="ATPase expression protein 3 "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS54483.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="HOGENOM:HBG059877"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI0000253458"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750L0"
FT                   /transl_table=1
FT                   /translation="MNKIVHKVAEAFRKNGVPRTKWLNPKTIYGLANQKLLGSVEAPHA
FT                   QGTGLNTVPQVEHYTKACRTKQRDMVRSYLEATGSTHFARLNTPAYNKSSALEFYAKLK
FT                   ALQRYTEGEEVLFQMSSVEVREIISRLVKLTQEGDQIPDEQRRFPTELFMDVAPVPNFN
FT                   DDPGILEQYIGILTHSAFYYHNTSKIDPIPHILRDLLHPQNEKTASLRTTTMFNDLIYY
FT                   FGKKSDYASCREYYSQMKLEKKTPNIETYRLLFLNLLKNMQIPKKQLPYKEMIFYLNDM
FT                   EKFGVPADAKIWAYCYHLLVESVSKKLLLEKMIQHNAPISPDFIVSILRTLDVDCKAIL
FT                   EFAKEYSIPFTPKLLRLCISKLCKEYKFESAWQLLTSLCRSTDVVTTGSVNILLNAAAE
FT                   KGRLDLAVLTYNSMKVQLGVTPDLRTHRLIFKAMARNGYHENFQDVYHWAVWSMKRSTS
FT                   GWFVHDAWSRRCESMIKQKCGSVTPPTTENMEKVAAILHRGVWDNRGLFIRCWGEYKEL
FT                   RHVFRLLGSIPPAYKGKTA"
     MNKIVHKVAE AFRKNGVPRT KWLNPKTIYG LANQKLLGSV EAPHAQGTGL NTVPQVEHYT        60
     KACRTKQRDM VRSYLEATGS THFARLNTPA YNKSSALEFY AKLKALQRYT EGEEVLFQMS       120
     SVEVREIISR LVKLTQEGDQ IPDEQRRFPT ELFMDVAPVP NFNDDPGILE QYIGILTHSA       180
     FYYHNTSKID PIPHILRDLL HPQNEKTASL RTTTMFNDLI YYFGKKSDYA SCREYYSQMK       240
     LEKKTPNIET YRLLFLNLLK NMQIPKKQLP YKEMIFYLND MEKFGVPADA KIWAYCYHLL       300
     VESVSKKLLL EKMIQHNAPI SPDFIVSILR TLDVDCKAIL EFAKEYSIPF TPKLLRLCIS       360
     KLCKEYKFES AWQLLTSLCR STDVVTTGSV NILLNAAAEK GRLDLAVLTY NSMKVQLGVT       420
     PDLRTHRLIF KAMARNGYHE NFQDVYHWAV WSMKRSTSGW FVHDAWSRRC ESMIKQKCGS       480
     VTPPTTENME KVAAILHRGV WDNRGLFIRC WGEYKELRHV FRLLGSIPPA YKGKTA           536
//

If you have problems or comments...

PBIL Back to PBIL home page