(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE375

ASHGO_7.PE375        Location/Qualifiers
FT   CDS             1036882..1038057
FT                   /codon_start=1
FT                   /gene_family="HOG000074728" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751276"
FT                   /gene_name="HAT1"
FT                   /locus_tag="AGL001W"
FT                   /product="Histone acetyltransferase type B catalytic
FT                   subunit"
FT                   /EC_number="2.3.1.48"
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin silencing at telomere "
FT                   /biological_process="histone acetylation"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="histone acetyltransferase complex "
FT                   /protein_id="AAS54489.2"
FT                   /db_xref="GO:0000123"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006348"
FT                   /db_xref="GO:0016573"
FT                   /db_xref="HOGENOM:HBG197707"
FT                   /db_xref="HOGENOM:HBG738699"
FT                   /db_xref="InterPro:IPR013523"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017380"
FT                   /db_xref="InterPro:IPR019467"
FT                   /db_xref="UniParc:UPI0001DB2C66"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750F5"
FT                   /transl_table=1
FT                   /translation="MAEELKPELWTTSSNSALKLSLVNDENAVQFSPIFTYPIFGQAEQ
FT                   LFGYQDLNILLAFDSVTFKPFLNIKYTKKLERGLDDVEGSILKFLPEGDVILKDEVEWV
FT                   DAFNGEREKFALPNSESKVAEYTSGGESFAIFKVHLSDPNIRQLHRRMQIFTLLFIEAA
FT                   SYIDEDDSAWDIFMTFNTSTRQCIGYTTTYKHWRYINGQEFDSSEKTTKRAKISQFIIF
FT                   PPYQSKSHGSHLYSAAIDVWSKEEKISEVTVEDPNEAFDDLRDRCDFMRLSGSGLSSSI
FT                   PEDVPIPRTWLTEQARKYKLSLVQFTRLVEMILLYDNSPNFEIQVKARLYQKNHEVLTG
FT                   MDSDTRKAKLQEAFTSLKEDYARILQKVPNRRRVLPSDEENAGESKRHKKE"
     MAEELKPELW TTSSNSALKL SLVNDENAVQ FSPIFTYPIF GQAEQLFGYQ DLNILLAFDS        60
     VTFKPFLNIK YTKKLERGLD DVEGSILKFL PEGDVILKDE VEWVDAFNGE REKFALPNSE       120
     SKVAEYTSGG ESFAIFKVHL SDPNIRQLHR RMQIFTLLFI EAASYIDEDD SAWDIFMTFN       180
     TSTRQCIGYT TTYKHWRYIN GQEFDSSEKT TKRAKISQFI IFPPYQSKSH GSHLYSAAID       240
     VWSKEEKISE VTVEDPNEAF DDLRDRCDFM RLSGSGLSSS IPEDVPIPRT WLTEQARKYK       300
     LSLVQFTRLV EMILLYDNSP NFEIQVKARL YQKNHEVLTG MDSDTRKAKL QEAFTSLKED       360
     YARILQKVPN RRRVLPSDEE NAGESKRHKK E                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page