(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE376

ASHGO_7.PE376        Location/Qualifiers
FT   CDS             1039149..1039748
FT                   /codon_start=1
FT                   /gene_family="HOG000066132" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928320"
FT                   /gene_name="LOC1"
FT                   /locus_tag="AGR001W"
FT                   /product="60S ribosomal subunit assembly/export protein
FT                   LOC1"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS54490.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG059879"
FT                   /db_xref="HOGENOM:HBG396584"
FT                   /db_xref="UniParc:UPI000025345F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750F4"
FT                   /transl_table=1
FT                   /translation="MAGKQTKTAKRAKTQNRTREVTSEVFQDSQARNQLANAPKVEKPS
FT                   ARKATKRQVKKEQAVVRLYGTRKKEKTYSEKELNIPTLNRAIVPGVKIKTGKKGKKFVD
FT                   DHDLLTLNRLIKTIGDKNDEVTESKLEKAKRLEEIRELKKQELERKEQAKKEKLDDKMD
FT                   ELKRKASVARTLRRKNKRHEKKLEDVPKSSKKVSFA"
     MAGKQTKTAK RAKTQNRTRE VTSEVFQDSQ ARNQLANAPK VEKPSARKAT KRQVKKEQAV        60
     VRLYGTRKKE KTYSEKELNI PTLNRAIVPG VKIKTGKKGK KFVDDHDLLT LNRLIKTIGD       120
     KNDEVTESKL EKAKRLEEIR ELKKQELERK EQAKKEKLDD KMDELKRKAS VARTLRRKNK       180
     RHEKKLEDVP KSSKKVSFA                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page