(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE389

ASHGO_7.PE389        Location/Qualifiers
FT   CDS             1059161..1059820
FT                   /codon_start=1
FT                   /gene_family="HOG000208642" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079583"
FT                   /locus_tag="AGR014W"
FT                   /orf_name="AGOS_AGR014W"
FT                   /product="AGR014Wp"
FT                   /biological_process="protein transport"
FT                   /protein_id="AAS54503.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG371348"
FT                   /db_xref="HOGENOM:HBG592869"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI000025346C"
FT                   /db_xref="UniProtKB/TrEMBL:Q750E1"
FT                   /transl_table=1
FT                   /translation="MGQGGSKIKVTATDKAILQLKLAKDNLHRHAKRTDTLIENERSEL
FT                   RELAKSLKGEIKQSRRARLLLKRIHYQQRLLDQCSDQLINLENMVMTIEFKLVEKQFVE
FT                   GLARGNEVLKKLNREFSGVEQLMDDVAEQVAYQEEIDQLLSNGPMSAGYGLQDELDREL
FT                   EQLEQEVNAQEALPELPSTNGLAPPKTRKSANKEDEPAGQPAAAPQREVEKPMLAS"
     MGQGGSKIKV TATDKAILQL KLAKDNLHRH AKRTDTLIEN ERSELRELAK SLKGEIKQSR        60
     RARLLLKRIH YQQRLLDQCS DQLINLENMV MTIEFKLVEK QFVEGLARGN EVLKKLNREF       120
     SGVEQLMDDV AEQVAYQEEI DQLLSNGPMS AGYGLQDELD RELEQLEQEV NAQEALPELP       180
     STNGLAPPKT RKSANKEDEP AGQPAAAPQR EVEKPMLAS                              219
//

If you have problems or comments...

PBIL Back to PBIL home page