(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE396

ASHGO_7.PE396        Location/Qualifiers
FT   CDS             complement(1070910..1072073)
FT                   /codon_start=1
FT                   /gene_family="HOG000217393" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079584"
FT                   /locus_tag="AGR021C"
FT                   /orf_name="AGOS_AGR021C"
FT                   /product="AGR021Cp"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cysteine biosynthetic process from
FT                   serine"
FT                   /protein_id="AAS54510.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006535"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG370933"
FT                   /db_xref="HOGENOM:HBG748215"
FT                   /db_xref="HSSP:1O58"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI0000253473"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D4"
FT                   /transl_table=1
FT                   /translation="MSNQQGLDWRTAITGVSVIVSVASLFYAYKTSSRLTDLAPPKNGV
FT                   EELIGNTPMVLLPSLSKFTGCKIYAKLELANPAGSAKDRVALNIVRTAETQGLLTRGHR
FT                   DVVFEGTSGSTGISIATICNALGYQSHISLPDDTSPEKLALLECLGAHVKKVKPASIVD
FT                   PDQYVNAAKKACKLLNEEGHGNKGIFADQFENEANWTIHYQNTGPEIYQQLGGRINAFI
FT                   AGCGTGGTIGGVSRYLKERLGDSVHTILADPQGSGFYNRINYGVMYDHVEKEGSRRRHQ
FT                   VDTIVEGIGLNRITRNFKCCEEYIDSSIRVTDEQAIKMAKYLCVNDGLFIGSSTAVNAV
FT                   AAVRVAQEMPAGSTLVLIACDSGSRHLSKFWKEASAVRNDIQLCDIV"
     MSNQQGLDWR TAITGVSVIV SVASLFYAYK TSSRLTDLAP PKNGVEELIG NTPMVLLPSL        60
     SKFTGCKIYA KLELANPAGS AKDRVALNIV RTAETQGLLT RGHRDVVFEG TSGSTGISIA       120
     TICNALGYQS HISLPDDTSP EKLALLECLG AHVKKVKPAS IVDPDQYVNA AKKACKLLNE       180
     EGHGNKGIFA DQFENEANWT IHYQNTGPEI YQQLGGRINA FIAGCGTGGT IGGVSRYLKE       240
     RLGDSVHTIL ADPQGSGFYN RINYGVMYDH VEKEGSRRRH QVDTIVEGIG LNRITRNFKC       300
     CEEYIDSSIR VTDEQAIKMA KYLCVNDGLF IGSSTAVNAV AAVRVAQEMP AGSTLVLIAC       360
     DSGSRHLSKF WKEASAVRND IQLCDIV                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page