(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE398

ASHGO_7.PE398        Location/Qualifiers
FT   CDS             complement(1074114..1076456)
FT                   /codon_start=1
FT                   /gene_family="HOG000162311" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775327"
FT                   /locus_tag="AGR023C"
FT                   /orf_name="AGOS_AGR023C"
FT                   /product="AGR023Cp"
FT                   /function="cysteine-type peptidase activity"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAS54512.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG371766"
FT                   /db_xref="HOGENOM:HBG746888"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016652"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI0000253475"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D2"
FT                   /transl_table=1
FT                   /translation="MCEVVKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNI
FT                   CLGCFQSFCHEHVNLHQQVVRRVQQATHDLYLNVYKIERPKATESAEKRLKLEVQDLSE
FT                   EELYETVWSLVRINNACTARLGSSKQKQKMDTTVVSKLEQIIRTRSSDFKDMAATWQLE
FT                   IKACPHSEQFVVPQDAMPVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKH
FT                   YQQSENNHPLAVKLGSLTSESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKE
FT                   KTLVELQVEQNMNWDFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGG
FT                   VKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNE
FT                   EFSSGRQQDAMEFLTYFIDKLDRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSSQ
FT                   VCEILQIPLLDSNDPQFLMDRLHSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLI
FT                   NPIRIKLQNWTPIKTSNQLFVPGLRDEKRLKLSQFKAHGRQPGEKIFEDSPDDNSNVPA
FT                   SAISFNPDEDKVISIISMGFSKNAALRALYNTGSEVERALNWIFEHMEDPELNAEFSVP
FT                   GTKKQAAVVDQGALDSMVSMGLAERHCRKALILNDGDVTRSVEWVFNNADNLDDDDTQE
FT                   SIDPPVSRDYGYPGDIPDYALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKL
FT                   MAVGGNENLQEIEKNGYIFIFNRIAPA"
     MCEVVKQLKI PSTIYKDDCG YCFETMINPN FGDGGPAEPE HQLNICLGCF QSFCHEHVNL        60
     HQQVVRRVQQ ATHDLYLNVY KIERPKATES AEKRLKLEVQ DLSEEELYET VWSLVRINNA       120
     CTARLGSSKQ KQKMDTTVVS KLEQIIRTRS SDFKDMAATW QLEIKACPHS EQFVVPQDAM       180
     PVRETCGDCD LDRNLWLCLH CGNIGCGREQ VGIEGHSHAL KHYQQSENNH PLAVKLGSLT       240
     SESNDIYCYS CNDEVAFPDP NRFSAVLAKF GIDLEGQVAK EKTLVELQVE QNMNWDFQMR       300
     DSGNEFTKKI FASKEYGCGL INLGNSCYLN SVVQVLFNGG VKDWNLDMLG DFPRDVVFPS       360
     TNLKCQLIKL RNALKIHPEK YQHGVKPASV KKCIGEDNEE FSSGRQQDAM EFLTYFIDKL       420
     DRKVFSKASS SNPNDLMRFM VEDRLECTKC EHVKYSSQVC EILQIPLLDS NDPQFLMDRL       480
     HSYFNGESLD IHCPQCSEIT VATKNSMLKT APATLLINPI RIKLQNWTPI KTSNQLFVPG       540
     LRDEKRLKLS QFKAHGRQPG EKIFEDSPDD NSNVPASAIS FNPDEDKVIS IISMGFSKNA       600
     ALRALYNTGS EVERALNWIF EHMEDPELNA EFSVPGTKKQ AAVVDQGALD SMVSMGLAER       660
     HCRKALILND GDVTRSVEWV FNNADNLDDD DTQESIDPPV SRDYGYPGDI PDYALSAVIC       720
     HKGNSVQSGH YVAFIKKAVD GEPKWVLYND EKLMAVGGNE NLQEIEKNGY IFIFNRIAPA       780
//

If you have problems or comments...

PBIL Back to PBIL home page