(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE399

ASHGO_7.PE399        Location/Qualifiers
FT   CDS             complement(1076692..1078125)
FT                   /codon_start=1
FT                   /gene_family="HOG000217005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751283"
FT                   /locus_tag="AGR024C"
FT                   /orf_name="AGOS_AGR024C"
FT                   /product="AGR024Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS54513.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG383328"
FT                   /db_xref="HOGENOM:HBG748731"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="UniParc:UPI0000253476"
FT                   /db_xref="UniProtKB/TrEMBL:Q750D1"
FT                   /transl_table=1
FT                   /translation="MIRSTVRGMVQRRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEI
FT                   CHSILPVMQEYAKSDVANVIVFDSACAPRAFCAGGDIVLMAKAMRRDMLEKVDDFFQGE
FT                   YTMNWMLATYPKPVVALMDGITMGGGVGLTIHVPFRVATENTKWAMPELDIGLHPDVGV
FT                   SFALPRIMTLGGQEGQLGYYLCLTGEVLQGADVYMAGLASHYVESTQHGALKERLGTVP
FT                   ITRKADETFANTNAVIEEFSSPLPDGYQFKYNKEELDVIERFFHYDVSYKELRKNLEAF
FT                   ASSNANSEVARNFAKATLEKLSTKSTVSAEITREQFRRNSQRDIQSAMKQDLITSTNLL
FT                   RNNELAEFENAVIHKLVEKAKTPYEWKNTSPSVADISKLLAADPANPIDLLETFGVTFK
FT                   NYRYHNKFTLPTEAAVQAYITGTDQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVN
FT                   LIIDRKCRMDNDSFLHWNY"
     MIRSTVRGMV QRRQMSSLVK FKTNNTARVV TLNRPEKLNA INHEICHSIL PVMQEYAKSD        60
     VANVIVFDSA CAPRAFCAGG DIVLMAKAMR RDMLEKVDDF FQGEYTMNWM LATYPKPVVA       120
     LMDGITMGGG VGLTIHVPFR VATENTKWAM PELDIGLHPD VGVSFALPRI MTLGGQEGQL       180
     GYYLCLTGEV LQGADVYMAG LASHYVESTQ HGALKERLGT VPITRKADET FANTNAVIEE       240
     FSSPLPDGYQ FKYNKEELDV IERFFHYDVS YKELRKNLEA FASSNANSEV ARNFAKATLE       300
     KLSTKSTVSA EITREQFRRN SQRDIQSAMK QDLITSTNLL RNNELAEFEN AVIHKLVEKA       360
     KTPYEWKNTS PSVADISKLL AADPANPIDL LETFGVTFKN YRYHNKFTLP TEAAVQAYIT       420
     GTDQSGRSMA VTRAETVKYF TEFNPVSRGK VGTEYVVNLI IDRKCRMDND SFLHWNY          477
//

If you have problems or comments...

PBIL Back to PBIL home page