(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE410

ASHGO_7.PE410        Location/Qualifiers
FT   CDS             complement(1090437..1091060)
FT                   /codon_start=1
FT                   /gene_family="HOG000217816" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775329"
FT                   /gene_name="RSM10"
FT                   /locus_tag="AGR035C"
FT                   /product="30S ribosomal protein S10, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAS54524.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG059895"
FT                   /db_xref="HOGENOM:HBG396854"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005731"
FT                   /db_xref="UniParc:UPI0000253480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750C2"
FT                   /transl_table=1
FT                   /translation="MLSVFGLRTVARCNSTLASGGARAAAAAGGKAGAQYSALPKSVHA
FT                   LYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPKPLPTRRER
FT                   WTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVGMKCNMFQ
FT                   RESVQLAQELADVPLAPGAPQTADEVVGAKVAELMQSPEFKKHL"
     MLSVFGLRTV ARCNSTLASG GARAAAAAGG KAGAQYSALP KSVHALYFQP LKLPVKHHDL        60
     VADLQLRAFD NQSLDFFANF ALRVGYYLGI PMTGPKPLPT RRERWTVIRA PFAHAKSKEN       120
     FERHTHKRLL RLWDANPEVV EMFLSYITKH SMAGVGMKCN MFQRESVQLA QELADVPLAP       180
     GAPQTADEVV GAKVAELMQS PEFKKHL                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page