(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE414

ASHGO_7.PE414        Location/Qualifiers
FT   CDS             complement(1096869..1098629)
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15751289"
FT                   /locus_tag="AGR039C"
FT                   /orf_name="AGOS_AGR039C"
FT                   /product="AGR039Cp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54528.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000253484"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B8"
FT                   /transl_table=1
FT                   /translation="MSGFVSDKPAVPKATSDSSSSAVSIEYAGNRNAWTRFTDSFKRAQ
FT                   VDTAVDLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPA
FT                   GLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWA
FT                   TVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLL
FT                   MAGFIIMAISLTAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSE
FT                   FIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSR
FT                   ASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYV
FT                   DRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRR
FT                   AMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQN
FT                   YLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRNST
FT                   LFKRLLDFWC"
     MSGFVSDKPA VPKATSDSSS SAVSIEYAGN RNAWTRFTDS FKRAQVDTAV DLEGKDADNG        60
     LNKTQQTLKH NIKTRHLTMI SLGTGIGTGL LVASGKALHF GGPAGLVIGY VTTSTMLYCV       120
     VQACCELGVA YATLPGNYNA YPTFLVDKGF GFAVALVYGL QWATVLPLEL VTASMTVKYW       180
     TSSVNPDVFV AIFYVFLLFI HFFGSRGYAE AEFIFNSLKV LLMAGFIIMA ISLTAGASEQ       240
     GYIGGQYWHD PGAFGGDRAI DRFKGICSVW VQAAFAYGGS EFIALTAAEQ ANPRESVPKA       300
     TKRWLYRVVV VFLLPVILIG FLVPHNSDQL LSAEGGSGSR ASPFVIAAAL HGVRVVPHII       360
     NFIILTSVIS VGNSAMYSAP RILLSLAEHG MCPKIFTYVD RQGRPLVTLI FVSLFGLIAF       420
     VAASNQEENV FTWLSAIAGL SQLFTWTAIA VSHVRFRRAM RVQGRSLGEL GYRANTGALG       480
     SYYAIFFNVI VLIAQFWIAI APIPKHGELD VEFFFQNYLA FPVLVVFYLG YKLWKRDFRL       540
     VIPSSEVDLL SHRQIFDEEV LLQEEAERKE RLRNSTLFKR LLDFWC                      586
//

If you have problems or comments...

PBIL Back to PBIL home page