(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE415

ASHGO_7.PE415        Location/Qualifiers
FT   CDS             complement(1099432..1101153)
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622781"
FT                   /locus_tag="AGR040C"
FT                   /orf_name="AGOS_AGR040C"
FT                   /product="AGR040Cp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54529.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000253485"
FT                   /db_xref="UniProtKB/TrEMBL:Q750B7"
FT                   /transl_table=1
FT                   /translation="MQDMTSSISSSKKDESYVKVSPNTVGSGDERRTGIMRGFIDSFRR
FT                   GRDVDLMCKADAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLI
FT                   LGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVF
FT                   PLQLVTAAMIIQYWTDINPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGF
FT                   VILGVVINCGGAGTSGYIGDKYWHEPRPFMNGFKGLCFVFCYAAFAYGGIEVMVLSASE
FT                   QENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGSRASPLVIAVSFHG
FT                   VKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFV
FT                   AMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEV
FT                   GYKARTGYWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFG
FT                   YKIYHKDWRICIPASEVDLISHRQVFDEDELKQEDLEWKLKLKSSPIWVRIYHFWC"
     MQDMTSSISS SKKDESYVKV SPNTVGSGDE RRTGIMRGFI DSFRRGRDVD LMCKADAEDG        60
     TTAKMKKTIK TRHLLMITLG TGIGTGLLVG NGSALAKAGP AGLILGYVVS SAMLYLIVEA       120
     AGELGICYSG MTGNYTAYSS LLVDPAMGFS VSWVYCIQWM TVFPLQLVTA AMIIQYWTDI       180
     NPDIFVAIIY AVIVFINLFG AKGYAEAEFF FNLCKVLMII GFVILGVVIN CGGAGTSGYI       240
     GDKYWHEPRP FMNGFKGLCF VFCYAAFAYG GIEVMVLSAS EQENPRKSIS SACKKVIYRI       300
     VLIYLLTTVI VCFLVPADHP SLASEGSRAS PLVIAVSFHG VKIVPHIINA VILIAVVSVG       360
     NSSLYSAPRL LLSLAEQGYA PKIFTYIDRQ GRPLPAFFVA MVFGLLAFLA ASPAQDDVFG       420
     WLLAISGLSQ MFIWMSICIS HIRFRDAMKA QGRSMGEVGY KARTGYWGSW IAVVTAFLIL       480
     IAQFWVAISP VETKGVDARS FFQSYLAFPI LLLAYFGYKI YHKDWRICIP ASEVDLISHR       540
     QVFDEDELKQ EDLEWKLKLK SSPIWVRIYH FWC                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page