(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE417

ASHGO_7.PE417        Location/Qualifiers
FT   CDS             1102383..1103879
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751290"
FT                   /gene_name="SLX4"
FT                   /locus_tag="AGR042W"
FT                   /product="Structure-specific endonuclease subunit SLX4 "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54531.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG059898"
FT                   /db_xref="InterPro:IPR018574"
FT                   /db_xref="UniParc:UPI0000253487"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750B5"
FT                   /transl_table=1
FT                   /translation="MDLRRAERNLKILGDANSDEDMPVAHSVEETQGQALFSESDEADA
FT                   EEDAAESPQSGVGGRTTTAESGGEEHREQVFLSTQVQGRIDEFEATEGARRQFRQLVTG
FT                   FTYAQEDGEANAGGRTAKRVPKVRRTRRNNTKVRSLTEFNTENFERLRKEDRARSLLTM
FT                   LSGKTQKVNNLLRGLQQERSRERAFHGCSVYNEGEWREIVRLLHERLPKATRSDVACIK
FT                   SYVYGDGLDETPWCASHARPPDCPAQSQERQGTCGPGDDELRIFTLSQLLEDQSASEDV
FT                   IPDSMDAGDAVSLGSPQPQAGLSQHSFCPDSTATSPLRPPATPLTRAPASPLPVRVYTA
FT                   PASPLDYIPDSEDDPYVLQGPSQARSPPSLLEVRRTLKNIGVRPGRSAAAVRKAAAAVA
FT                   RIEAASDAASLGTASDADRRSALFLRMTALVRRSPRLLAHIYCLRPVALDDLRAVLEAD
FT                   DDFIALLDDSLIRQWADFTGICVKNDTSDSQRPPQPLESQ"
     MDLRRAERNL KILGDANSDE DMPVAHSVEE TQGQALFSES DEADAEEDAA ESPQSGVGGR        60
     TTTAESGGEE HREQVFLSTQ VQGRIDEFEA TEGARRQFRQ LVTGFTYAQE DGEANAGGRT       120
     AKRVPKVRRT RRNNTKVRSL TEFNTENFER LRKEDRARSL LTMLSGKTQK VNNLLRGLQQ       180
     ERSRERAFHG CSVYNEGEWR EIVRLLHERL PKATRSDVAC IKSYVYGDGL DETPWCASHA       240
     RPPDCPAQSQ ERQGTCGPGD DELRIFTLSQ LLEDQSASED VIPDSMDAGD AVSLGSPQPQ       300
     AGLSQHSFCP DSTATSPLRP PATPLTRAPA SPLPVRVYTA PASPLDYIPD SEDDPYVLQG       360
     PSQARSPPSL LEVRRTLKNI GVRPGRSAAA VRKAAAAVAR IEAASDAASL GTASDADRRS       420
     ALFLRMTALV RRSPRLLAHI YCLRPVALDD LRAVLEADDD FIALLDDSLI RQWADFTGIC       480
     VKNDTSDSQR PPQPLESQ                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page