(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE423

ASHGO_7.PE423        Location/Qualifiers
FT   CDS             complement(1124613..1125974)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18928327"
FT                   /gene_name="HOG1"
FT                   /locus_tag="AGR048C"
FT                   /product="Mitogen-activated protein kinase HOG1 "
FT                   /EC_number="2.7.11.24"
FT                   /function="ATP binding"
FT                   /function="MAP kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54537.1"
FT                   /db_xref="GO:0004707"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008352"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000025348D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750A9"
FT                   /transl_table=1
FT                   /translation="MWRARTMASQEEFYRTQIFGTVFEITNRYADLNPVGMGAFGLVCS
FT                   AVDTYTQQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLEDIFLSPLEDIYF
FT                   VTELQGTDLHRLLQTRPLEKQFLQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCD
FT                   LKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPL
FT                   FPGKDHVHQFSIITDLLGSPPKDVIDTICSENTLKFVTSLPHRDPVPFTERFKNLKPDA
FT                   VDLLEKMLVFDPKKRITAGDALTHPYLAPYHDPTDEPVADAKFDWNFNDADLPVDTWRV
FT                   MMYSEILDFHQVPDSQINPNDTFDDQVAAATAAAEAARQQQQQKQQQQKQQQQRHQGVE
FT                   HGAQHVQLQHGAKQLSADPLVGDSNGGIPLNVSAANETLNNFANQAAQYATDFE"
     MWRARTMASQ EEFYRTQIFG TVFEITNRYA DLNPVGMGAF GLVCSAVDTY TQQPVAIKKI        60
     MKPFSTAVLA KRTYRELKLL KHLRHENLIC LEDIFLSPLE DIYFVTELQG TDLHRLLQTR       120
     PLEKQFLQYF LYQILRGLKY VHSAGVIHRD LKPSNILINE NCDLKICDFG LARIQDPQMT       180
     GYVSTRYYRA PEIMLTWQKY NVEVDIWSAG CIFAEMIEGK PLFPGKDHVH QFSIITDLLG       240
     SPPKDVIDTI CSENTLKFVT SLPHRDPVPF TERFKNLKPD AVDLLEKMLV FDPKKRITAG       300
     DALTHPYLAP YHDPTDEPVA DAKFDWNFND ADLPVDTWRV MMYSEILDFH QVPDSQINPN       360
     DTFDDQVAAA TAAAEAARQQ QQQKQQQQKQ QQQRHQGVEH GAQHVQLQHG AKQLSADPLV       420
     GDSNGGIPLN VSAANETLNN FANQAAQYAT DFE                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page