(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE428

ASHGO_7.PE428        Location/Qualifiers
FT   CDS             1131617..1132231
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15751296"
FT                   /gene_name="DPB4"
FT                   /locus_tag="AGR053W"
FT                   /product="DNA polymerase epsilon subunit D "
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54542.1"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000253492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750A4"
FT                   /transl_table=1
FT                   /translation="MVCGESNAAAISAKYVDNDPLQRPAARATPANESHICDLMPPKGW
FT                   KKDAQGNYPTTSYIKEQEKLTVDDLLFPRSIITSLAKDAVHQAVQTAEQDPRVMLSKDA
FT                   SLALQRSSTVFVNHLLMHARQIAQSNDRKSCSGEDVLKALDQIGLAGFESVVRERVVEY
FT                   EKEVQRRRAEKTPAADEGQAEEGDAADEEEGSHKRAKLDEH"
     MVCGESNAAA ISAKYVDNDP LQRPAARATP ANESHICDLM PPKGWKKDAQ GNYPTTSYIK        60
     EQEKLTVDDL LFPRSIITSL AKDAVHQAVQ TAEQDPRVML SKDASLALQR SSTVFVNHLL       120
     MHARQIAQSN DRKSCSGEDV LKALDQIGLA GFESVVRERV VEYEKEVQRR RAEKTPAADE       180
     GQAEEGDAAD EEEGSHKRAK LDEH                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page