(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE55

ASHGO_7.PE55         Location/Qualifiers
FT   CDS             112950..113915
FT                   /codon_start=1
FT                   /gene_family="HOG000203918" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774753"
FT                   /locus_tag="AGOS_AGL316W"
FT                   /product="AGL316Wp"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54175.2"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG021570"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR017390"
FT                   /db_xref="UniParc:UPI0001DB2AC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q751S0"
FT                   /transl_table=1
FT                   /translation="MSSWQTIENDAGVFTQLVKDLGVEGVQFEEVPLVEHLATLNSPLY
FT                   GVIFLFKYERQNYAGEAPVQGEFEQACPEGLFFAQQTIPNACATQAVLNTLLSIGNDHR
FT                   NSIRLGTVLSDFLQFTAGFSDPALRGETITNSVAIRNVHNSFTSPDPFEHEEPSPSAQS
FT                   SEAAFHYSGFVPYNGYIYELDGLHPRPIIHRAYGANNDDPAVFAANLAALLSARMSMVA
FT                   DSSFSVTAIVRDKLEHLTEQLDAPDVDDGRRFWLQDLIQDELRVRDRWAKEIALRRDGL
FT                   VGLVYAVFKQMLGSMSDDEFAQRRAAAAARTNERERRRTC"
     MSSWQTIEND AGVFTQLVKD LGVEGVQFEE VPLVEHLATL NSPLYGVIFL FKYERQNYAG        60
     EAPVQGEFEQ ACPEGLFFAQ QTIPNACATQ AVLNTLLSIG NDHRNSIRLG TVLSDFLQFT       120
     AGFSDPALRG ETITNSVAIR NVHNSFTSPD PFEHEEPSPS AQSSEAAFHY SGFVPYNGYI       180
     YELDGLHPRP IIHRAYGANN DDPAVFAANL AALLSARMSM VADSSFSVTA IVRDKLEHLT       240
     EQLDAPDVDD GRRFWLQDLI QDELRVRDRW AKEIALRRDG LVGLVYAVFK QMLGSMSDDE       300
     FAQRRAAAAA RTNERERRRT C                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page