(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE61

ASHGO_7.PE61         Location/Qualifiers
FT   CDS             complement(123092..123370)
FT                   /codon_start=1
FT                   /gene_family="HOG000229493" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18078999"
FT                   /gene_name="RPL43"
FT                   /locus_tag="AGL310C"
FT                   /product="60S ribosomal protein L43 "
FT                   /function="metal ion binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS54181.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG128467"
FT                   /db_xref="HOGENOM:HBG610728"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI000025332C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751L1"
FT                   /transl_table=1
FT                   /translation="MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKK
FT                   AVKRGAAGIWNCSSCKKTVAGGAYTFSTAAAATVRSTIRRLREMAEA"
     MAKRTKKVGI TGKYGVRYGS SLRRQVKKLE VQQHARYDCS FCGKKAVKRG AAGIWNCSSC        60
     KKTVAGGAYT FSTAAAATVR STIRRLREMA EA                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page