(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE65

ASHGO_7.PE65         Location/Qualifiers
FT   CDS             complement(126331..130110)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749045"
FT                   /gene_name="BUD4"
FT                   /locus_tag="AGL306C"
FT                   /product="Bud site selection protein 4 homolog "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="cell septum"
FT                   /protein_id="AAS54185.1"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0030428"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG060038"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR012966"
FT                   /db_xref="UniParc:UPI0000253330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751K7"
FT                   /transl_table=1
FT                   /translation="MDEQSSGQDVDQSLDTLLKEIDLKMQLRDGEEGRRASAQSEGSLR
FT                   LPAVRMLERGMVASASHKSVTFDEEPPSVHEYSVVMDSSAGTSECAEEEREGADGYECA
FT                   ADTMRVLYDEDTDSSCMGSERALAGPAAEGIVPEGYKEADLLGTERAGSGTPSLSYDDA
FT                   AGLGSPPHVIFTIKPTSPLNAYDRGSWEPLQSNTAMDTPPRGGTAVSQHGLFAKAPKLP
FT                   AIPSPNSRRRVSYAGSDSYPSDDSATDKRSLTDKTVPDNRGENERGGFGYENSDRNPSI
FT                   ETGTTDEYQSAGEYKSMSSSEANDDSKTEASVEDLRISNKPQRDTTIQDLHATTLPRSS
FT                   STLIPPALPPLDPSFFGRLARSPSYSPIRDRGSSEGSVGEHDSSLEQDHELGMGQQSAR
FT                   TNSSASGNSSDSVMVKPLSLFSNSQVDSLHLGAPAPDNSTPNKEALPSACPPDAMKSIG
FT                   TQTSILEDKAESGPSQSSATSEKSVMLPNFPRFESFFDDSYPFGHDSDRSNNSVSYSKR
FT                   TLKPSNYLSIWHLQEAQMRHDSPAFSANSQFSCKMVGESKRTSLESSRLSAKYESRFKF
FT                   KFKPKLVSRRRIYYNKDQWRNFQEPPTRYYSNCTESDHISSDVPGTPVSPSIKSRNLCH
FT                   GRTRGNMKMVERVNSLCSANERLSSAGNGDETFLSASSNLDVTSRRPSVDIISEISTKD
FT                   LLPKIKQDSDGFNELIKTFVDHDEQSQQTDSTIASYRRGTRDTTIYHIWEHSIQENSIS
FT                   DYGNSPTAGKGTISKLLDNHEVEFDGKNSFVTGLGIIKKTDQDSRVDVLRIDSTQGIEA
FT                   IQSFSPYSYRNAFDPVTPTKSAYHGCEALQASQMGTPFRPAISTTLQAQSGLGHKRPAV
FT                   ERPTTAQLGNYVSAEMSPEVQEPAEETKKRTDLQDNGQLYFVFVGIEQLALRDIERHSA
FT                   ECSIEFDNGNNVVQSEWLPLPKSGSMSLNQEYSVIIAEESLPNMIITLKCRYKSPKKEL
FT                   VEITEKVPLKSKCCGLGKPKYKQVKKLLRREMDFDEWDYKIAQDGSFARCKEQIDEELL
FT                   KNVRYKKQQFRWTLLSEWERDHSKEHKRKRAWELPRLPAHPAGALVVDMCYLPRTSRFE
FT                   KFPKTLQIARRVVNKFKEQKAIAMEGFMWQEGGDTEVLKRRYFTLNGTQLVAHHEITKK
FT                   PKAMINLLRVEKLLTEAEISREMLSSSSRCFTDLVLLHECFVLFFENGEEIMFNPDTKT
FT                   EKLEWIEKLRKVIELNRFHQPWVKKFLNSSENIL"
     MDEQSSGQDV DQSLDTLLKE IDLKMQLRDG EEGRRASAQS EGSLRLPAVR MLERGMVASA        60
     SHKSVTFDEE PPSVHEYSVV MDSSAGTSEC AEEEREGADG YECAADTMRV LYDEDTDSSC       120
     MGSERALAGP AAEGIVPEGY KEADLLGTER AGSGTPSLSY DDAAGLGSPP HVIFTIKPTS       180
     PLNAYDRGSW EPLQSNTAMD TPPRGGTAVS QHGLFAKAPK LPAIPSPNSR RRVSYAGSDS       240
     YPSDDSATDK RSLTDKTVPD NRGENERGGF GYENSDRNPS IETGTTDEYQ SAGEYKSMSS       300
     SEANDDSKTE ASVEDLRISN KPQRDTTIQD LHATTLPRSS STLIPPALPP LDPSFFGRLA       360
     RSPSYSPIRD RGSSEGSVGE HDSSLEQDHE LGMGQQSART NSSASGNSSD SVMVKPLSLF       420
     SNSQVDSLHL GAPAPDNSTP NKEALPSACP PDAMKSIGTQ TSILEDKAES GPSQSSATSE       480
     KSVMLPNFPR FESFFDDSYP FGHDSDRSNN SVSYSKRTLK PSNYLSIWHL QEAQMRHDSP       540
     AFSANSQFSC KMVGESKRTS LESSRLSAKY ESRFKFKFKP KLVSRRRIYY NKDQWRNFQE       600
     PPTRYYSNCT ESDHISSDVP GTPVSPSIKS RNLCHGRTRG NMKMVERVNS LCSANERLSS       660
     AGNGDETFLS ASSNLDVTSR RPSVDIISEI STKDLLPKIK QDSDGFNELI KTFVDHDEQS       720
     QQTDSTIASY RRGTRDTTIY HIWEHSIQEN SISDYGNSPT AGKGTISKLL DNHEVEFDGK       780
     NSFVTGLGII KKTDQDSRVD VLRIDSTQGI EAIQSFSPYS YRNAFDPVTP TKSAYHGCEA       840
     LQASQMGTPF RPAISTTLQA QSGLGHKRPA VERPTTAQLG NYVSAEMSPE VQEPAEETKK       900
     RTDLQDNGQL YFVFVGIEQL ALRDIERHSA ECSIEFDNGN NVVQSEWLPL PKSGSMSLNQ       960
     EYSVIIAEES LPNMIITLKC RYKSPKKELV EITEKVPLKS KCCGLGKPKY KQVKKLLRRE      1020
     MDFDEWDYKI AQDGSFARCK EQIDEELLKN VRYKKQQFRW TLLSEWERDH SKEHKRKRAW      1080
     ELPRLPAHPA GALVVDMCYL PRTSRFEKFP KTLQIARRVV NKFKEQKAIA MEGFMWQEGG      1140
     DTEVLKRRYF TLNGTQLVAH HEITKKPKAM INLLRVEKLL TEAEISREML SSSSRCFTDL      1200
     VLLHECFVLF FENGEEIMFN PDTKTEKLEW IEKLRKVIEL NRFHQPWVKK FLNSSENIL       1259
//

If you have problems or comments...

PBIL Back to PBIL home page