(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE91

ASHGO_7.PE91         Location/Qualifiers
FT   CDS             183784..184407
FT                   /codon_start=1
FT                   /gene_family="HOG000000709" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927770"
FT                   /gene_name="ROX3"
FT                   /gene_synonym="MED19"
FT                   /locus_tag="AGL280W"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 19"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS54211.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG060115"
FT                   /db_xref="HOGENOM:HBG204148"
FT                   /db_xref="InterPro:IPR013942"
FT                   /db_xref="UniParc:UPI000025334A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751I6"
FT                   /transl_table=1
FT                   /translation="MGTVHDDATMPSYYYYVDPAGPAYEPQQPNPIDDLISVYGLQDIS
FT                   RQVARTNADGTKAVKLRKSYKNQIQDLSGKFSVIPTRENGKGGEISPIVFQNTDGDAVR
FT                   ERGMGPEEWRRAQVFRDQALFEAPTMDWDMCAEVISQFERSYPGEFKNQGFEVEDLAFD
FT                   LDGSGANGAALGGKAKKRKSRSNGSSMATPNSDLQEDIKRRRLE"
     MGTVHDDATM PSYYYYVDPA GPAYEPQQPN PIDDLISVYG LQDISRQVAR TNADGTKAVK        60
     LRKSYKNQIQ DLSGKFSVIP TRENGKGGEI SPIVFQNTDG DAVRERGMGP EEWRRAQVFR       120
     DQALFEAPTM DWDMCAEVIS QFERSYPGEF KNQGFEVEDL AFDLDGSGAN GAALGGKAKK       180
     RKSRSNGSSM ATPNSDLQED IKRRRLE                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page