(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE94

ASHGO_7.PE94         Location/Qualifiers
FT   CDS             187329..189344
FT                   /codon_start=1
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749059"
FT                   /locus_tag="AGL277W"
FT                   /orf_name="AGOS_AGL277W"
FT                   /product="AGL277Wp"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS54214.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG060117"
FT                   /db_xref="HOGENOM:HBG324208"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000025334D"
FT                   /db_xref="UniProtKB/TrEMBL:Q751I3"
FT                   /transl_table=1
FT                   /translation="MTPLARTRHAGDLRTPEQWNARGRGAGCYKVAAGRGCAAASAPSD
FT                   AGAMTETHATCSGVSSRGASDNADKCDARASDTENALAQWPEDEVAAMGRAFAAKYGLP
FT                   NDEDIFGRAAALARAPRRFGTIGLLTEADRAACAEEVEHPWRIPRKLVHVVAASAMSAA
FT                   VQGMDETVINGANLFYPKALGLGGGTVREDWLIGLVNGAPYLCCAVAACWLTDWANNVL
FT                   GRKRVIFVTCFLSGLFCLLQGVGPAGPAGWRYLFAMRFLLGFGLGIKSATVNVYLAECA
FT                   PKELRGIVCMNWQAFTAFGVMWGYVASLVFYRVGDAGIGGGLNWRLMLASAALPAVFVL
FT                   FQLPHCPESPRWLMGKGRYPEAYAALLQLRKHRLLACRDLFYQHVLLVQESTLQLSYFT
FT                   RLKEIFTVRRNRNAFVAAFICAFMQQFCAINVIAYYSSVIFLQAGFSEIASLCSSLGFG
FT                   IINTVFAIPAYFMIDRFGRRFLLLSTLPWLGVFLLVTGFAFWIKDTKASIGVISFGIYI
FT                   FSAIYSFGMGVVPFVYAGEVFPLYVRAIGSSLFAVVLWGFNFILALTWPSMLRAMKPQG
FT                   AFGFYAAWNFIGYFLVYFFLPETKQLTLEELDEVFSVPLMKRADYYLSQMWPDFQETVL
FT                   RKKNVSRPPPLEYERVQLLDSAGSTRKPSFDHVEHV"
     MTPLARTRHA GDLRTPEQWN ARGRGAGCYK VAAGRGCAAA SAPSDAGAMT ETHATCSGVS        60
     SRGASDNADK CDARASDTEN ALAQWPEDEV AAMGRAFAAK YGLPNDEDIF GRAAALARAP       120
     RRFGTIGLLT EADRAACAEE VEHPWRIPRK LVHVVAASAM SAAVQGMDET VINGANLFYP       180
     KALGLGGGTV REDWLIGLVN GAPYLCCAVA ACWLTDWANN VLGRKRVIFV TCFLSGLFCL       240
     LQGVGPAGPA GWRYLFAMRF LLGFGLGIKS ATVNVYLAEC APKELRGIVC MNWQAFTAFG       300
     VMWGYVASLV FYRVGDAGIG GGLNWRLMLA SAALPAVFVL FQLPHCPESP RWLMGKGRYP       360
     EAYAALLQLR KHRLLACRDL FYQHVLLVQE STLQLSYFTR LKEIFTVRRN RNAFVAAFIC       420
     AFMQQFCAIN VIAYYSSVIF LQAGFSEIAS LCSSLGFGII NTVFAIPAYF MIDRFGRRFL       480
     LLSTLPWLGV FLLVTGFAFW IKDTKASIGV ISFGIYIFSA IYSFGMGVVP FVYAGEVFPL       540
     YVRAIGSSLF AVVLWGFNFI LALTWPSMLR AMKPQGAFGF YAAWNFIGYF LVYFFLPETK       600
     QLTLEELDEV FSVPLMKRAD YYLSQMWPDF QETVLRKKNV SRPPPLEYER VQLLDSAGST       660
     RKPSFDHVEH V                                                            671
//

If you have problems or comments...

PBIL Back to PBIL home page