(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE97

ASHGO_7.PE97         Location/Qualifiers
FT   CDS             193740..195938
FT                   /codon_start=1
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622199"
FT                   /locus_tag="AGL274W"
FT                   /orf_name="AGOS_AGL274W"
FT                   /product="AGL274Wp"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54217.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="UniParc:UPI0000253350"
FT                   /db_xref="UniProtKB/TrEMBL:Q751I0"
FT                   /transl_table=1
FT                   /translation="MGLPSVLVSESGTLSARFAAKMISSQLGILGPALRRSGVQLRHNH
FT                   MSRLASMRRGMHITGAARNKQEEGASAEQGQGASGISHAMLAAKEQEANRDLLDAGAQA
FT                   ALYRLLLAANYPQYVVSRFETPGIASSAECVSLYSEALQKVGRQADADAVRRSVGAPAG
FT                   AEAAAAVSPAGASAGSGYGGPVFPGAGMYGAGQGTRKEPLHVVVTESTFTVISRWIKWL
FT                   LVFGLVTYGVSEGFRYITENTTLLKSAETADKSVDVAKTNVKFEDVRGCDEARAELEEI
FT                   VDFLKDPAKYESLGGNLPKGVLLTGPPGTGKTLLARATAGEAGVDFFFMSGSEFDEVYV
FT                   GVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKDQAYAKQTLNQLLVELDGFSQT
FT                   SGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDVRGRADILQHHMRKVTLAPDVDPS
FT                   IIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMTHFEWAKDKILMGAERKTMVLTEA
FT                   SRRATAYHEAGHAIMALYTPGAVPLYKATILPRGRALGITFQLPEMDKVDVTKKECLAR
FT                   LDVCMGGKIAEELIYGKDNTTSGCGSDLQNATSTARAMVTQYGMSEQVGPVNLADKWES
FT                   WSGKIRDIADNEVVEILKASEERARNILREKQKELNRLAQGLMEYETLDSVEIQKVCKG
FT                   EPISKAKMSTNKIVEGPDSDDRKEIGGDKSKIPVLINA"
     MGLPSVLVSE SGTLSARFAA KMISSQLGIL GPALRRSGVQ LRHNHMSRLA SMRRGMHITG        60
     AARNKQEEGA SAEQGQGASG ISHAMLAAKE QEANRDLLDA GAQAALYRLL LAANYPQYVV       120
     SRFETPGIAS SAECVSLYSE ALQKVGRQAD ADAVRRSVGA PAGAEAAAAV SPAGASAGSG       180
     YGGPVFPGAG MYGAGQGTRK EPLHVVVTES TFTVISRWIK WLLVFGLVTY GVSEGFRYIT       240
     ENTTLLKSAE TADKSVDVAK TNVKFEDVRG CDEARAELEE IVDFLKDPAK YESLGGNLPK       300
     GVLLTGPPGT GKTLLARATA GEAGVDFFFM SGSEFDEVYV GVGAKRIREL FAQARARAPA       360
     IIFIDELDAI GGKRNPKDQA YAKQTLNQLL VELDGFSQTS GIIIIGATNF PESLDKALTR       420
     PGRFDKIVNV DLPDVRGRAD ILQHHMRKVT LAPDVDPSII ARGTPGLSGA ELMNLVNQAA       480
     VYACQQNAIA VDMTHFEWAK DKILMGAERK TMVLTEASRR ATAYHEAGHA IMALYTPGAV       540
     PLYKATILPR GRALGITFQL PEMDKVDVTK KECLARLDVC MGGKIAEELI YGKDNTTSGC       600
     GSDLQNATST ARAMVTQYGM SEQVGPVNLA DKWESWSGKI RDIADNEVVE ILKASEERAR       660
     NILREKQKEL NRLAQGLMEY ETLDSVEIQK VCKGEPISKA KMSTNKIVEG PDSDDRKEIG       720
     GDKSKIPVLI NA                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page