(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE99

ASHGO_7.PE99         Location/Qualifiers
FT   CDS             complement(197944..199587)
FT                   /codon_start=1
FT                   /gene_family="HOG000130111" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079001"
FT                   /locus_tag="AGL272C"
FT                   /orf_name="AGOS_AGL272C"
FT                   /product="AGL272Cp"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="AAS54219.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG389886"
FT                   /db_xref="HOGENOM:HBG565875"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR017458"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI0000253352"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H8"
FT                   /transl_table=1
FT                   /translation="MLSRTVIRSARSLAAVQLGRTVARVARPAVMIAGRRFASAKAQPT
FT                   EVSSILEERIRGVSEEANLNETGRVLSVGDGIARVFGLNNVQAEELVEFSSGVKGMALN
FT                   LEPGQVGIVLFGSDRLVKEGEVVKRTGKIVDVPVGPEMLGRVVDALGNPIDGKGAIKAS
FT                   GTSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTI
FT                   LNQKRWNSSNDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSVIVAATASEAAPL
FT                   QYIAPFTAAAIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYL
FT                   HSRLLERAAKMSEKNGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKG
FT                   IRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLA
FT                   RGERLTQLLTQSQYSPLAAEEQVPLIYAGVNGYLDNIELSRIGEFEKEFLAYLKASHEE
FT                   IVSAIREKGELSKDLLAKLKSATESFVATF"
     MLSRTVIRSA RSLAAVQLGR TVARVARPAV MIAGRRFASA KAQPTEVSSI LEERIRGVSE        60
     EANLNETGRV LSVGDGIARV FGLNNVQAEE LVEFSSGVKG MALNLEPGQV GIVLFGSDRL       120
     VKEGEVVKRT GKIVDVPVGP EMLGRVVDAL GNPIDGKGAI KASGTSRAQV KAPGILPRRS       180
     VHEPVQTGLK AVDALVPIGR GQRELIIGDR QTGKTAVALD TILNQKRWNS SNDESKKLYC       240
     VYVAVGQKRS TVAQLVQTLE QHDAMKYSVI VAATASEAAP LQYIAPFTAA AIGEWFRDNG       300
     KHALIVYDDL SKQAVAYRQL SLLLRRPPGR EAYPGDVFYL HSRLLERAAK MSEKNGGGSL       360
     TALPVIETQG GDVSAYIPTN VISITDGQIF LEAELFYKGI RPAINVGLSV SRVGSAAQVK       420
     ALKQVAGSLK LFLAQYREVA AFAQFGSDLD ASTKQTLARG ERLTQLLTQS QYSPLAAEEQ       480
     VPLIYAGVNG YLDNIELSRI GEFEKEFLAY LKASHEEIVS AIREKGELSK DLLAKLKSAT       540
     ESFVATF                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page