(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_8.PE4

ASHGO_8.PE4          Location/Qualifiers
FT   CDS             5926..6945
FT                   /codon_start=1
FT                   /gene_family="HOG000138209" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080157"
FT                   /gene_name="VAR1"
FT                   /locus_tag="AMI004W"
FT                   /orf_name="AgVAR1"
FT                   /product="Ribosomal protein VAR1, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrial ribosome"
FT                   /protein_id="AAS50171.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005761"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG060119"
FT                   /db_xref="HOGENOM:HBG512138"
FT                   /db_xref="InterPro:IPR007980"
FT                   /db_xref="UniParc:UPI00002523BD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75G41"
FT                   /transl_table=3
FT                   /translation="MKYNLLNNMKINNKKLKLKLILMMITMKRLNNMNQHNIYKNRYYN
FT                   KNNNLQYLNKLNTYNNKMYYFNKQLMNNMLIIDNTFNNLLKKMMMSNNILMTNLKFEHR
FT                   TNSIHIKYYFYNYMNINNDELSKLYNNYMMSINNQMINLLNNDNNSLNNLMTKYYNKKV
FT                   YINTYKLNYMYLDTELLSQTLTNIYNNNGLSLKSLKMIINKLPFNNDMLLSKNYVNKMN
FT                   KYNLTINNNLNNNKKDLINLYTLDNKLLDLSITNNMLLGKYLVGSNIQLKGRTLNRNIT
FT                   RTMKMNIMKGTFNNYMYQWSKLNNLYKLNYMSTNINKTNNTFINKNGMFNIKIKLNTI"
     MKYNLLNNMK INNKKLKLKL ILMMITMKRL NNMNQHNIYK NRYYNKNNNL QYLNKLNTYN        60
     NKMYYFNKQL MNNMLIIDNT FNNLLKKMMM SNNILMTNLK FEHRTNSIHI KYYFYNYMNI       120
     NNDELSKLYN NYMMSINNQM INLLNNDNNS LNNLMTKYYN KKVYINTYKL NYMYLDTELL       180
     SQTLTNIYNN NGLSLKSLKM IINKLPFNND MLLSKNYVNK MNKYNLTINN NLNNNKKDLI       240
     NLYTLDNKLL DLSITNNMLL GKYLVGSNIQ LKGRTLNRNI TRTMKMNIMK GTFNNYMYQW       300
     SKLNNLYKLN YMSTNINKTN NTFINKNGMF NIKIKLNTI                              339
//

If you have problems or comments...

PBIL Back to PBIL home page