(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_8.PE5

ASHGO_8.PE5          Location/Qualifiers
FT   CDS             7040..7186
FT                   /codon_start=1
FT                   /gene_family="HOG000034188" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753603"
FT                   /gene_name="ATP8"
FT                   /locus_tag="AMI005W"
FT                   /orf_name="AgATP8"
FT                   /product="ATP synthase protein 8 "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="AAS50172.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059889"
FT                   /db_xref="HOGENOM:HBG398772"
FT                   /db_xref="InterPro:IPR009230"
FT                   /db_xref="UniParc:UPI00002523BE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75G40"
FT                   /transl_table=3
FT                   /translation="MPQMIPFFFMNQLTYGFTFILTILFLTSYVFLPMILRLYISRLYI
FT                   SKL"
     MPQMIPFFFM NQLTYGFTFI LTILFLTSYV FLPMILRLYI SRLYISKL                     48
//

If you have problems or comments...

PBIL Back to PBIL home page