(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_8.PE6

ASHGO_8.PE6          Location/Qualifiers
FT   CDS             7252..8043
FT                   /codon_start=1
FT                   /gene_family="HOG000253874" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753604"
FT                   /gene_name="ATP6"
FT                   /locus_tag="AMI006W"
FT                   /orf_name="AgATP6"
FT                   /product="ATP synthase subunit a "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, coupling factor F(o)"
FT                   /protein_id="AAS50173.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0045263"
FT                   /db_xref="HOGENOM:HBG261838"
FT                   /db_xref="HOGENOM:HBG734175"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniParc:UPI00002523BF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75G39"
FT                   /transl_table=3
FT                   /translation="MYLNNNNNMKYYINSPLEQFEIRDLLGLTSPMMDFSFINITNFGL
FT                   YTMITLLVILTMNLMTNNYNKLVGSNWYLSQEMIYDTIMNMVKTQIGGKVWGYYFPLVY
FT                   TFFITIFTMNLISMIPYSFAMTSHVVFVVSMSMIIWLGTTIIGFYTHGLKFFGLFLPTG
FT                   TPLILVPLLVSIELLSYFARTISLGLRLSANIMAGHLLIVILGGLLFNLMAMNILTFLL
FT                   GFLPMIAILGIVCLEFAITIIQAYVWCILMSSYLKDTIYLH"
     MYLNNNNNMK YYINSPLEQF EIRDLLGLTS PMMDFSFINI TNFGLYTMIT LLVILTMNLM        60
     TNNYNKLVGS NWYLSQEMIY DTIMNMVKTQ IGGKVWGYYF PLVYTFFITI FTMNLISMIP       120
     YSFAMTSHVV FVVSMSMIIW LGTTIIGFYT HGLKFFGLFL PTGTPLILVP LLVSIELLSY       180
     FARTISLGLR LSANIMAGHL LIVILGGLLF NLMAMNILTF LLGFLPMIAI LGIVCLEFAI       240
     TIIQAYVWCI LMSSYLKDTI YLH                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page