(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE1

ASPNC_1.PE1          Location/Qualifiers
FT   CDS             join(<134..282,484..700)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959383"
FT                   /orf_name="An01g00010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36846.1"
FT                   /db_xref="UniParc:UPI0000EF9E97"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B1"
FT                   /transl_table=1
FT                   /translation="PPTFQLQLSTVEADPPRVKQIGNDNKPISRDKNGALVKHEGVSEH
FT                   SADFIVSMTEKSAFMIFMIDLLNANRHLRLAGGIGKEQVALNIRGVTTSEPIQRWSHLL
FT                   FISALVSVSSRDLLVCI"
     PPTFQLQLST VEADPPRVKQ IGNDNKPISR DKNGALVKHE GVSEHSADFI VSMTEKSAFM        60
     IFMIDLLNAN RHLRLAGGIG KEQVALNIRG VTTSEPIQRW SHLLFISALV SVSSRDLLVC       120
     I                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page