(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE10

ASPNC_1.PE10         Location/Qualifiers
FT   CDS             join(complement(25393..25634),complement(25197..25320),
FT                   complement(24810..25096),complement(24270..24741))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000281450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874682"
FT                   /orf_name="An01g00100"
FT                   /product="Catalytic activity: Pyruvate + lipoamide  "
FT                   /function="catalytic activity"
FT                   /protein_id="CAK36861.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG753264"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI0000EF9EC1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C0"
FT                   /transl_table=1
FT                   /translation="MAAPRLFRPAARLLSSRLTSAPLRPQTACAPSILRFRGYATESGT
FT                   KEVTVRDALNEALAEELESNKKTFILGEEVAQYNGAYKVTRGLLDRFGPKRVIDTPITE
FT                   AGFCGLAVGAALAGLHPICEFMTFNFAMQAIDHVINSAAKTHYMSGGIQPCNITFRGPN
FT                   GFAAGVAAQHSQDYSAWYGSIPGLKVVAPWSSEDAKGLLKAAIRDPNPVVVLENELLYG
FT                   QAFPMSEAAQKDDFVLPIGKAKIERPGKDLTIVTLSRCVGHSLNAAAQLKQKYGVDAEV
FT                   INLRSVKPLDVETIIQSLKKTGRIMCVESGFPMFGVSSEILALSMEYGFDYLTAPAVRV
FT                   TGAEVPTPYAVGLENMSFPQEDTIVSQAAKLLRL"
     MAAPRLFRPA ARLLSSRLTS APLRPQTACA PSILRFRGYA TESGTKEVTV RDALNEALAE        60
     ELESNKKTFI LGEEVAQYNG AYKVTRGLLD RFGPKRVIDT PITEAGFCGL AVGAALAGLH       120
     PICEFMTFNF AMQAIDHVIN SAAKTHYMSG GIQPCNITFR GPNGFAAGVA AQHSQDYSAW       180
     YGSIPGLKVV APWSSEDAKG LLKAAIRDPN PVVVLENELL YGQAFPMSEA AQKDDFVLPI       240
     GKAKIERPGK DLTIVTLSRC VGHSLNAAAQ LKQKYGVDAE VINLRSVKPL DVETIIQSLK       300
     KTGRIMCVES GFPMFGVSSE ILALSMEYGF DYLTAPAVRV TGAEVPTPYA VGLENMSFPQ       360
     EDTIVSQAAK LLRL                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page