(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE107

ASPNC_1.PE107        Location/Qualifiers
FT   CDS             283362..284579
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806405"
FT                   /orf_name="An01g01170"
FT                   /product="Similarity to hypothetical protein BAC47708.1 -
FT                   Bradyrhizobium japonicum"
FT                   /protein_id="CAK43493.1"
FT                   /db_xref="UniParc:UPI0000EF9D95"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L7"
FT                   /transl_table=1
FT                   /translation="MKTFTSALIGAAALAQNVNSSLLSGPAGLEFPNVTGLMNHTVHVS
FT                   NGGSAHCISGIVKVNATTDKNLKFAYNLPSNQSQVTRTLVSLWSSGGDGYVKSLTSGTQ
FT                   RITGSYDIEATYCLPAGENSKTTKVQLLTHGIGVDRHYWDFASGYSYVDTAAAAGYATF
FT                   LYNRLGVGASSKEDPLNAVQSPLELEILEALASKLRQGTLGDRAFTTVVGVGHSFGSIL
FT                   TQGVTAAYPKTLDAAVLTGFTLNSNGLPGFGLGLNAAIASETQPYRFSGLSTGYLVAGT
FT                   PVSNQIAFFYDPGFDPEILSLADATKGSFTLGELFTLTHVINATSEFQGPVAVVAGNED
FT                   LPFCNGNCSSPSNILAGLVPALYPEVSEENTATYVAPAVGHALNLHYAAPGAFNFIQDF
FT                   LKKHNV"
     MKTFTSALIG AAALAQNVNS SLLSGPAGLE FPNVTGLMNH TVHVSNGGSA HCISGIVKVN        60
     ATTDKNLKFA YNLPSNQSQV TRTLVSLWSS GGDGYVKSLT SGTQRITGSY DIEATYCLPA       120
     GENSKTTKVQ LLTHGIGVDR HYWDFASGYS YVDTAAAAGY ATFLYNRLGV GASSKEDPLN       180
     AVQSPLELEI LEALASKLRQ GTLGDRAFTT VVGVGHSFGS ILTQGVTAAY PKTLDAAVLT       240
     GFTLNSNGLP GFGLGLNAAI ASETQPYRFS GLSTGYLVAG TPVSNQIAFF YDPGFDPEIL       300
     SLADATKGSF TLGELFTLTH VINATSEFQG PVAVVAGNED LPFCNGNCSS PSNILAGLVP       360
     ALYPEVSEEN TATYVAPAVG HALNLHYAAP GAFNFIQDFL KKHNV                       405
//

If you have problems or comments...

PBIL Back to PBIL home page