(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE109

ASPNC_1.PE109        Location/Qualifiers
FT   CDS             288459..289091
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234460" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875712"
FT                   /orf_name="An01g01190"
FT                   /product="Similarity: the predicted A. niger protein
FT                   contains a phosphoglycerate mutase motif "
FT                   /protein_id="CAK43495.1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0000EF9D97"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L9"
FT                   /transl_table=1
FT                   /translation="MALKVHLVRHAESVHNVTHDFSQLDPELTPLGLQQATGLGQLFPY
FT                   APQVGVIITSPLKRAIQTTLTAFSHILDKRYFDPDSGDGVENGAVLFLEPDLQERSALP
FT                   CDTGSPTRVLEAAFPRLGFQDLAEGWQVKEDFYSPADEAVEERAQRMRSRIAAVCEDLQ
FT                   HQGRTDVVVVTHGVFMKFLSGDPDIDLPKAGWRSYAVGTGTVFSKCS"
     MALKVHLVRH AESVHNVTHD FSQLDPELTP LGLQQATGLG QLFPYAPQVG VIITSPLKRA        60
     IQTTLTAFSH ILDKRYFDPD SGDGVENGAV LFLEPDLQER SALPCDTGSP TRVLEAAFPR       120
     LGFQDLAEGW QVKEDFYSPA DEAVEERAQR MRSRIAAVCE DLQHQGRTDV VVVTHGVFMK       180
     FLSGDPDIDL PKAGWRSYAV GTGTVFSKCS                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page