(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE11

ASPNC_1.PE11         Location/Qualifiers
FT   CDS             join(26335..26528,26592..27842,27960..28281,28347..28373)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110310"
FT                   /orf_name="An01g00110"
FT                   /product="Similarity to hypothetical protein SPAC1039.02 -
FT                   Schizosaccharomyces pombe"
FT                   /function="hydrolase activity"
FT                   /biological_process="nucleotide catabolic process "
FT                   /protein_id="CAK36862.1"
FT                   /db_xref="GO:0009166"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG736951"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR014485"
FT                   /db_xref="UniParc:UPI0000EF9EC2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C1"
FT                   /transl_table=1
FT                   /translation="MSSNYYLLFSASVTFLLFFLSPFVRAVQPTAPEPIEAPLRDLKWG
FT                   QLNFLHTTDTHGWLAGHLQEPSYSADWGDYISFATRMREKAESMGVDLLVIDTGDRVEG
FT                   NGLYDSSDPKGIYISKILREQHIDLMSSGNHELYKESTASAEFFTTTLNFAGHYLASNI
FT                   DFYDPRTNAFRPLAPRFTKIVTKQLGIRIVAFGFLFDFKGNANNTVVRPVGETIKEAWF
FT                   QEAIRDHEVDLFLVIGHAPVHSEEYWDIWREIRSLRWSTPIQFFGGHYHIRDYAKYDRM
FT                   SYGLASGRFMETIGFMSISGLSTHRQPGQSALASSLWPWDRFHFNRKYIDNNLLSFYHH
FT                   TGLNETTFPTEHGQNVSRLIQESRSALQLDEVYGCAPHDLFMSRAKYPGEGNIYTWLET
FT                   EVLPLSVRDVSRAGKPAVVIVNTGAIRFDIFKGPFTKDNTYIVSPFTSGFRYVKDIPYS
FT                   RAYYLADVLNRGPGILTEGPQLDNGYAEPDLIPGYTTHDDGGNDGDDTIHSPIDFFRVP
FT                   NVIRGTPRWDASEPPETVDLVYIDFIESNVAAVAPFAGINADFSRDSDVYMPNTTLTGL
FT                   IMDWIKGNWPCEETTNGLLFS"
     MSSNYYLLFS ASVTFLLFFL SPFVRAVQPT APEPIEAPLR DLKWGQLNFL HTTDTHGWLA        60
     GHLQEPSYSA DWGDYISFAT RMREKAESMG VDLLVIDTGD RVEGNGLYDS SDPKGIYISK       120
     ILREQHIDLM SSGNHELYKE STASAEFFTT TLNFAGHYLA SNIDFYDPRT NAFRPLAPRF       180
     TKIVTKQLGI RIVAFGFLFD FKGNANNTVV RPVGETIKEA WFQEAIRDHE VDLFLVIGHA       240
     PVHSEEYWDI WREIRSLRWS TPIQFFGGHY HIRDYAKYDR MSYGLASGRF METIGFMSIS       300
     GLSTHRQPGQ SALASSLWPW DRFHFNRKYI DNNLLSFYHH TGLNETTFPT EHGQNVSRLI       360
     QESRSALQLD EVYGCAPHDL FMSRAKYPGE GNIYTWLETE VLPLSVRDVS RAGKPAVVIV       420
     NTGAIRFDIF KGPFTKDNTY IVSPFTSGFR YVKDIPYSRA YYLADVLNRG PGILTEGPQL       480
     DNGYAEPDLI PGYTTHDDGG NDGDDTIHSP IDFFRVPNVI RGTPRWDASE PPETVDLVYI       540
     DFIESNVAAV APFAGINADF SRDSDVYMPN TTLTGLIMDW IKGNWPCEET TNGLLFS          597
//

If you have problems or comments...

PBIL Back to PBIL home page