(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE115

ASPNC_1.PE115        Location/Qualifiers
FT   CDS             complement(299013..300797)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000120896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875713"
FT                   /orf_name="An01g01260"
FT                   /product="Catalytic activity: beta-D-glucuronoside + H2O  "
FT                   /EC_number="3.2.1.31"
FT                   /function="beta-glucuronidase activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAK36851.1"
FT                   /db_xref="GO:0004566"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG474923"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000EF9DBD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M5"
FT                   /transl_table=1
FT                   /translation="MLKPQQTPFRDIVSLDGIWKFALGSSDNETATPWTAPLATDLECP
FT                   VPASYNDIFVDRQIHDHVGWVYYQRQAIVPRGWSQQQYLVRVDAATHKGRIYINDHLVA
FT                   EHVGGYTPFEADITSLVSAGDSFRLTIAVNNVLTHETIPPGRIEVLEYTGKKTQVYQHD
FT                   FFNYAGLARSVSLYSVPKQHIQDIKVVTDVNGATGQIKYLVTVTNATTERIKIDVVDED
FT                   GRTVAEASGTHGNVTIDSVRLWQPGDAYLYQFRVSIVGLDDSILDTYSVATGVRTVKVS
FT                   GNKFLINDKPFYFTGFGKHEDSNVRGKGYDAAYMVHDFQLMNWMGANSFRTSHYPYAEE
FT                   VMEFADRHGIVVIDETPAVGLAYSIGAGVSSEDSPQTFTPEGINNNTREAHKQAIRELI
FT                   ARDKNHASVVMWSIANEPASQEAGAREYFTPLVDLAHELDSDRPICFANYGDATYEVDR
FT                   ISDMFDVLCLNRYFGWYSQTGEIEEAEAALETELLGWEGKYDKPIVMTEYGADTLAGLH
FT                   SVLGLPWSEEFQVELLDMYHRVFDRVESVVGEHVWNFADFQAVVGVGRVDGNKKGVFTR
FT                   DRKPKAAVQTLRSRWSQL"
     MLKPQQTPFR DIVSLDGIWK FALGSSDNET ATPWTAPLAT DLECPVPASY NDIFVDRQIH        60
     DHVGWVYYQR QAIVPRGWSQ QQYLVRVDAA THKGRIYIND HLVAEHVGGY TPFEADITSL       120
     VSAGDSFRLT IAVNNVLTHE TIPPGRIEVL EYTGKKTQVY QHDFFNYAGL ARSVSLYSVP       180
     KQHIQDIKVV TDVNGATGQI KYLVTVTNAT TERIKIDVVD EDGRTVAEAS GTHGNVTIDS       240
     VRLWQPGDAY LYQFRVSIVG LDDSILDTYS VATGVRTVKV SGNKFLINDK PFYFTGFGKH       300
     EDSNVRGKGY DAAYMVHDFQ LMNWMGANSF RTSHYPYAEE VMEFADRHGI VVIDETPAVG       360
     LAYSIGAGVS SEDSPQTFTP EGINNNTREA HKQAIRELIA RDKNHASVVM WSIANEPASQ       420
     EAGAREYFTP LVDLAHELDS DRPICFANYG DATYEVDRIS DMFDVLCLNR YFGWYSQTGE       480
     IEEAEAALET ELLGWEGKYD KPIVMTEYGA DTLAGLHSVL GLPWSEEFQV ELLDMYHRVF       540
     DRVESVVGEH VWNFADFQAV VGVGRVDGNK KGVFTRDRKP KAAVQTLRSR WSQL             594
//

If you have problems or comments...

PBIL Back to PBIL home page