(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE119

ASPNC_1.PE119        Location/Qualifiers
FT   CDS             join(complement(310784..310988),complement(310346..310397),
FT                   complement(309947..310232))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875714"
FT                   /orf_name="An01g01300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43502.1"
FT                   /db_xref="UniParc:UPI0000EF9DC1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M9"
FT                   /transl_table=1
FT                   /translation="MRLLTYLLLTIYATSAVSTDLSVEEECGSLGVMKVDPADLPEGVT
FT                   LADVRKCADHPLGHLPHPGAATGGWHHPPSPDPPASPSPARDAPPAKRLLDEDIDGALD
FT                   LPALAIAPAVIEIGAIPPQQCTRAHHRARSNVYPRKPHRSVPQHGPIFDDNGLPAQPVH
FT                   RAQARPIAKHHIVPNIH"
     MRLLTYLLLT IYATSAVSTD LSVEEECGSL GVMKVDPADL PEGVTLADVR KCADHPLGHL        60
     PHPGAATGGW HHPPSPDPPA SPSPARDAPP AKRLLDEDID GALDLPALAI APAVIEIGAI       120
     PPQQCTRAHH RARSNVYPRK PHRSVPQHGP IFDDNGLPAQ PVHRAQARPI AKHHIVPNIH       180
//

If you have problems or comments...

PBIL Back to PBIL home page