(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE120

ASPNC_1.PE120        Location/Qualifiers
FT   CDS             join(complement(312007..312317),complement(311854..311953),
FT                   complement(311706..311804),complement(311419..311610))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217119" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110561"
FT                   /orf_name="An01g01310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43503.1"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI0000EF9DC2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N0"
FT                   /transl_table=1
FT                   /translation="MIFSFAPIIGLLSLISPVIATTDPLNYRNIPGYVTSSSLNVTTLV
FT                   DFIKSRSDLSILSEKIDELGGFAQAFDTDPNWKFTFFAPNNDAFELYTGAYFDSFEPTP
FT                   KGKWWLGNTIIHHYVPNSRLTSSSFNETLQRFQTATYLFVGSQMQDGAIVLNQVANVVE
FT                   SDIPVTSTHQHRSSNPTFHGCHKHSLQGVARILSSHIVDFSQPLRIGQACPELLVIIRM
FT                   SCCVVDPAKRN"
     MIFSFAPIIG LLSLISPVIA TTDPLNYRNI PGYVTSSSLN VTTLVDFIKS RSDLSILSEK        60
     IDELGGFAQA FDTDPNWKFT FFAPNNDAFE LYTGAYFDSF EPTPKGKWWL GNTIIHHYVP       120
     NSRLTSSSFN ETLQRFQTAT YLFVGSQMQD GAIVLNQVAN VVESDIPVTS THQHRSSNPT       180
     FHGCHKHSLQ GVARILSSHI VDFSQPLRIG QACPELLVII RMSCCVVDPA KRN              233
//

If you have problems or comments...

PBIL Back to PBIL home page