(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE125

ASPNC_1.PE125        Location/Qualifiers
FT   CDS             join(complement(323257..323338),complement(322917..323201),
FT                   complement(322013..322857))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653764"
FT                   /orf_name="An01g01360"
FT                   /product="Similarity to hypothetical transmembrane protein
FT                   CAD18032.1 - Ralstonia solanacearum "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43508.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG329624"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniParc:UPI0000EF9DC7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N5"
FT                   /transl_table=1
FT                   /translation="MQILKIFLAVATAVHVHGLIQDVPSLNGPVMMVPDTPGSKDRTNQ
FT                   FQHPGLWHSHSQLELMRNNVLKGVEPWASAYTRFAKDPYSSASYEMQGPYPVISRGQIS
FT                   NYTSFHDDSRAAYQNAIMWYITRNESHWNRSTTILDAWGSNLENIIGTDRSLLIGIEGS
FT                   IFANAAEIMRWEGGWVEEGATFKGGSGLSVQLYWLFARQSIIIGQANYGMASIMGLLNF
FT                   AVYLDDVALYNYALYAYKYDRCAGFPYNYLASTGQNSEAGRDQTHVQDALQWTALAARV
FT                   VANQEYDLFALENNLIFTAAEYAGKYLMNQTVPYDASFYRCEVVLVDGPWANISAINRY
FT                   IGYQDGKTNPAAWGLIYYEALERGIEVPWTSRVKDVYDASVKGQTSPVDPFSWADLLFA
FT                   VAEE"
     MQILKIFLAV ATAVHVHGLI QDVPSLNGPV MMVPDTPGSK DRTNQFQHPG LWHSHSQLEL        60
     MRNNVLKGVE PWASAYTRFA KDPYSSASYE MQGPYPVISR GQISNYTSFH DDSRAAYQNA       120
     IMWYITRNES HWNRSTTILD AWGSNLENII GTDRSLLIGI EGSIFANAAE IMRWEGGWVE       180
     EGATFKGGSG LSVQLYWLFA RQSIIIGQAN YGMASIMGLL NFAVYLDDVA LYNYALYAYK       240
     YDRCAGFPYN YLASTGQNSE AGRDQTHVQD ALQWTALAAR VVANQEYDLF ALENNLIFTA       300
     AEYAGKYLMN QTVPYDASFY RCEVVLVDGP WANISAINRY IGYQDGKTNP AAWGLIYYEA       360
     LERGIEVPWT SRVKDVYDAS VKGQTSPVDP FSWADLLFAV AEE                         403
//

If you have problems or comments...

PBIL Back to PBIL home page