(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE129

ASPNC_1.PE129        Location/Qualifiers
FT   CDS             join(complement(335021..335132),complement(334615..334949))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875720"
FT                   /orf_name="An01g01400"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   slr0318 - Synechocystis sp"
FT                   /protein_id="CAK43512.1"
FT                   /db_xref="HOGENOM:HBG326670"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI0000EF9DE4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N9"
FT                   /transl_table=1
FT                   /translation="MSPIPSYSRPGRGQHFQDAYGFAEACIAGDRMEIAGQTGMSPTST
FT                   DVPPTLEEEVAQAFNNINEVILYTLEKAKPDLRASVKSGWDRVVKIRTYHVQLPQTREK
FT                   IIGLMVENVKKWCPDHQPTWTMLGIEALPFEGQNLEIEVDVFLG"
     MSPIPSYSRP GRGQHFQDAY GFAEACIAGD RMEIAGQTGM SPTSTDVPPT LEEEVAQAFN        60
     NINEVILYTL EKAKPDLRAS VKSGWDRVVK IRTYHVQLPQ TREKIIGLMV ENVKKWCPDH       120
     QPTWTMLGIE ALPFEGQNLE IEVDVFLG                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page