(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE131

ASPNC_1.PE131        Location/Qualifiers
FT   CDS             join(complement(337659..338198),complement(337537..337604),
FT                   complement(337462..337487),complement(337168..337395),
FT                   complement(336861..337093))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806410"
FT                   /orf_name="An01g01420"
FT                   /product="Similarity to integral membrane protein PTH11 -
FT                   Magnaporthe grisea"
FT                   /protein_id="CAK43514.1"
FT                   /db_xref="UniParc:UPI0000EF9DE6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P1"
FT                   /transl_table=1
FT                   /translation="MHLRCPSDAYHPGCRQNMKKGCLPSKDLDIAGDRSESVRMERNYV
FT                   SASQVQATGYTMIALSSAVVIARFSLIFWKLRSLQVEDGCILLSWACFLAMSIAYIIVT
FT                   PVVYKIDAYTDGKIGPWATMLSDALFMIKVFFANTMLLWASLWSVKLSFLFLYRRLLQD
FT                   LPGEMKWWYAVLFFCIVDLYWGSYLQLYLMPKYACMVHRWGVQYTPRCFALPGFYQNTM
FT                   LSEQVMVLPLRLVVSLRLPLGQKISVAAVFALGTICVIMAVVRVIQIGTRANNDSTPSS
FT                   SWLAFWAVIVGCLPAFAIIYRRTKNTHRYRSSYVGMSSSAYVPQDDVALSEIITDRENA
FT                   GTEDVGLKAFNTTPELPMELSGEE"
     MHLRCPSDAY HPGCRQNMKK GCLPSKDLDI AGDRSESVRM ERNYVSASQV QATGYTMIAL        60
     SSAVVIARFS LIFWKLRSLQ VEDGCILLSW ACFLAMSIAY IIVTPVVYKI DAYTDGKIGP       120
     WATMLSDALF MIKVFFANTM LLWASLWSVK LSFLFLYRRL LQDLPGEMKW WYAVLFFCIV       180
     DLYWGSYLQL YLMPKYACMV HRWGVQYTPR CFALPGFYQN TMLSEQVMVL PLRLVVSLRL       240
     PLGQKISVAA VFALGTICVI MAVVRVIQIG TRANNDSTPS SSWLAFWAVI VGCLPAFAII       300
     YRRTKNTHRY RSSYVGMSSS AYVPQDDVAL SEIITDRENA GTEDVGLKAF NTTPELPMEL       360
     SGEE                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page