(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE133

ASPNC_1.PE133        Location/Qualifiers
FT   CDS             join(341069..342041,342129..342172)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158806" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875723"
FT                   /orf_name="An01g01440"
FT                   /product="Similarity to hypothetical protein CAD21096.1 -
FT                   Neurospora crassa"
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAK43516.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG323871"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniParc:UPI0000EF9DE8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P3"
FT                   /transl_table=1
FT                   /translation="MQMSSTHPNTSYTLAWICALPEEYEVAIAFLDEIHGIPQHQPLED
FT                   KNAYLLGRIGQHHVVMVCLPAGRMGTAAAASVAENLCRTFWSVRYGLLVGIGGGVPGVV
FT                   SGKDIRLGDVVVSVPGGGNGGVVQYDLEDGEVHHGQLNSPPEKLLSYVTLLNILMRSPR
FT                   ISGNCFREQLELLGQEYEYPAHLEDRLFCSRYWHQFEGGCEACGNNCGEIYRNKRDDTL
FT                   PAVHLGTIASGNTVVGDGVTRDMINHRYGNSILCFEMEAAGIMNALPCLVVRGISDYAD
FT                   SRKNDEWRPRAIAGACSYAKALILHIPREEVPQHENLVHVTDLDKGGYCWSLAFTER"
     MQMSSTHPNT SYTLAWICAL PEEYEVAIAF LDEIHGIPQH QPLEDKNAYL LGRIGQHHVV        60
     MVCLPAGRMG TAAAASVAEN LCRTFWSVRY GLLVGIGGGV PGVVSGKDIR LGDVVVSVPG       120
     GGNGGVVQYD LEDGEVHHGQ LNSPPEKLLS YVTLLNILMR SPRISGNCFR EQLELLGQEY       180
     EYPAHLEDRL FCSRYWHQFE GGCEACGNNC GEIYRNKRDD TLPAVHLGTI ASGNTVVGDG       240
     VTRDMINHRY GNSILCFEME AAGIMNALPC LVVRGISDYA DSRKNDEWRP RAIAGACSYA       300
     KALILHIPRE EVPQHENLVH VTDLDKGGYC WSLAFTER                               338
//

If you have problems or comments...

PBIL Back to PBIL home page